Mock Version: 0.9.14 Mock Version: 0.9.14 ENTER do(['bash', '--login', '-c', 'rpmbuild -bs --target ppc --nodeps builddir/build/SPECS/parrot.spec'], False, '/var/lib/mock/dist-f9-build-442640-71971/root/', None, 86400, True, 0, 101, 102, None, logger=) Executing command: ['bash', '--login', '-c', 'rpmbuild -bs --target ppc --nodeps builddir/build/SPECS/parrot.spec'] warning: Could not canonicalize hostname: ppc7.fedora.phx.redhat.com Building target platforms: ppc Building for target ppc Wrote: /builddir/build/SRPMS/parrot-1.0.0-6.fc9.src.rpm Child returncode was: 0 LEAVE do --> ENTER do(['bash', '--login', '-c', 'rpmbuild -bb --target ppc --nodeps builddir/build/SPECS/parrot.spec'], False, '/var/lib/mock/dist-f9-build-442640-71971/root/', None, 86400, True, 0, 101, 102, None, logger=) Executing command: ['bash', '--login', '-c', 'rpmbuild -bb --target ppc --nodeps builddir/build/SPECS/parrot.spec'] Building target platforms: ppc Building for target ppc Executing(%prep): /bin/sh -e /var/tmp/rpm-tmp.94031 + umask 022 + cd /builddir/build/BUILD + LANG=C + export LANG + unset DISPLAY + cd /builddir/build/BUILD + rm -rf parrot-1.0.0 + /usr/bin/gzip -dc /builddir/build/SOURCES/parrot-1.0.0.tar.gz + tar -xf - + STATUS=0 + '[' 0 -ne 0 ']' + cd parrot-1.0.0 ++ /usr/bin/id -u + '[' 101 = 0 ']' ++ /usr/bin/id -u + '[' 101 = 0 ']' + /bin/chmod -Rf a+rX,u+w,g-w,o-w . + echo 'Patch #0 (parrot-install_files.patch):' Patch #0 (parrot-install_files.patch): + patch -p0 -s + echo 'Patch #1 (parrot-1.0.0-rpath-removal.patch):' + patch -p0 -b --suffix .rpatch -s Patch #1 (parrot-1.0.0-rpath-removal.patch): + /usr/bin/perl -pi -e 's,"lib/,"lib/, if (/CONST_STRING\(interp,/)' src/library.c + /usr/bin/perl -pi -e 's,'\''/usr/lib'\'','\''/usr/lib'\'',;s,runtime/lib/,runtime/lib/,' tools/dev/install_files.pl + cat + chmod +x /builddir/build/BUILD/parrot-1.0.0/parrot-prov + exit 0 Executing(%build): /bin/sh -e /var/tmp/rpm-tmp.93860 + umask 022 + cd /builddir/build/BUILD + cd parrot-1.0.0 + LANG=C + export LANG + unset DISPLAY ++ echo '-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32' ++ /usr/bin/perl -pi -e s/-O2// + RPM_OPT_FLAGS=' -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32' + /usr/bin/perl Configure.pl --prefix=/usr --libdir=/usr/lib --sysconfdir=/etc --infodir=/usr/share/info --mandir=/usr/share/man --cc=gcc --cxx=g++ '--optimize= -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32' --parrot_is_shared --lex=/usr/bin/flex --yacc=/usr/bin/yacc '--libs=-lcurses -lm' Parrot Version 1.0.0 Configure 2.0 Copyright (C) 2001-2009, Parrot Foundation. Hello, I'm Configure. My job is to poke and prod your system to figure out how to build Parrot. The process is completely automated, unless you passed in the `--ask' flag on the command line, in which case I'll prompt you for a few pieces of info. Since you're running this program, you obviously have Perl 5--I'll be pulling some defaults from its configuration. init::manifest - Check MANIFEST.....................................done. init::defaults - Set Configure's default values.....................done. init::install - Set up installation paths..........................done. init::hints - Load platform and local hints files................done. init::headers - Find header files distributed with Parrot..........done. inter::progs - Determine what C compiler and linker to use........done. inter::make - Is make installed...................................yes. inter::lex - Is lex installed...........................user defined. inter::yacc - Is yacc installed..........................user defined. auto::gcc - Is your C compiler actually gcc................yes, 4.3. auto::glibc - Is GNU libc installed...............................yes. auto::backtrace - Does libc have the backtrace* functions.............yes. auto::fink - Determine Fink location on Darwin...............skipped. auto::macports - Determine Macports location on Darwin...........skipped. auto::msvc - Is your C compiler actually Visual C++..........skipped. auto::attributes - Detect compiler attributes.........................done. auto::warnings - Detect supported compiler warnings..........set for gcc. init::optimize - Enable optimization.................................yes. inter::shlibs - Determine flags for building shared libraries.....-fPIC. inter::libparrot - Should parrot link against a shared library.........yes. inter::charset - Which charset files should be compiled in..........done. inter::encoding - Which encoding files should be compiled in.........done. inter::types - What types should Parrot use.......................done. auto::ops - Which opcode files should be compiled in...........done. auto::pmc - Which pmc files should be compiled in..............done. auto::alignptrs - Determine your minimum pointer alignment........ 1 byte. auto::headers - Probe for C headers................................done. auto::sizes - Determine some sizes...............................done. auto::byteorder - Compute native byteorder for wordsize........big-endian. auto::va_ptr - Test the type of va_ptr........................register. auto::format - What formats should be used for sprintf............done. auto::isreg - Does your C library have a working S_ISREG..........yes. auto::arch - Determine CPU architecture and OS..................done. auto::jit - Determine JIT capability............................yes. auto::cpu - Generate CPU specific stuff........................done. auto::funcptr - Does compiler support function pointer casts........yes. auto::cgoto - Does your compiler support computed goto............yes. auto::inline - Does your compiler support inline...................yes. auto::gc - Determine allocator to use.........................done. auto::memalign - Does your C library support memalign................yes. auto::signal - Determine some signal stuff........................done. auto::socklen_t - Determine whether there is socklen_t................yes. auto::neg_0 - Determine whether negative zero can be printed......yes. auto::env - Does your C library have setenv / unsetenv.........both. auto::gmp - Does your platform support GMP......................yes. auto::readline - Does your platform support readline.................yes. auto::gdbm - Does your platform support gdbm.....................yes. auto::pcre - Does your platform support pcre....................done. auto::opengl - Does your platform support OpenGL....................no. auto::crypto - Does your platform support crypto...........yes, 0.9.8g. auto::gettext - Does your configuration include gettext.............yes. auto::snprintf - Test snprintf......................................done. auto::perldoc - Is perldoc installed................................yes. auto::pod2man - Is pod2man installed................................yes. auto::ctags - Is (exuberant) ctags installed......................yes. auto::revision - Determine Parrot's revision........................done. auto::icu - Is ICU installed....................................yes. gen::config_h - Generate C headers.................................done. gen::core_pmcs - Generate core pmc list.............................done. gen::crypto - Generate Digest PMC files..........................done. gen::parrot_include - Generate runtime/parrot/include....................done. gen::opengl - Generating OpenGL bindings......................skipped. gen::call_list - Generate NCI signature list........................done. gen::makefiles - Generate makefiles and other build files...........done. gen::platform - Move platform files into place.....................done. gen::config_pm - Record configuration data for later retrieval......done. Okay, we're done! You can now use `gmake' to build your Parrot. After that, you can use `gmake test' to run the test suite. Happy Hacking, The Parrot Team ++ pwd + export LD_LIBRARY_PATH=/builddir/build/BUILD/parrot-1.0.0/blib/lib + LD_LIBRARY_PATH=/builddir/build/BUILD/parrot-1.0.0/blib/lib + make Compiling with: xx.c gcc -I./include -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO -fPIC -I. -o xx.o -c xx.c /usr/bin/perl tools/build/vtable_extend.pl /usr/bin/perl tools/build/pbcversion_h.pl > include/parrot/pbcversion.h /usr/bin/perl tools/build/pmc2c.pl --vtable /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/default.pmc /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/fixedintegerarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/fixedintegerarray.pmc /usr/bin/perl tools/build/ops2pm.pl src/ops/core.ops src/ops/bit.ops src/ops/cmp.ops src/ops/debug.ops src/ops/experimental.ops src/ops/io.ops src/ops/math.ops src/ops/object.ops src/ops/pic.ops src/ops/pmc.ops src/ops/set.ops src/ops/string.ops src/ops/sys.ops src/ops/var.ops /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/continuation.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/continuation.pmc /usr/bin/perl tools/build/ops2c.pl C --core /usr/bin/perl tools/build/ops2c.pl CSwitch --core /usr/bin/perl tools/build/ops2c.pl CGoto --core /usr/bin/perl tools/build/ops2c.pl CGP --core /usr/bin/perl tools/build/c2str.pl src/debug.c > src/debug.str /usr/bin/perl tools/build/c2str.pl src/dynext.c > src/dynext.str /usr/bin/perl tools/build/c2str.pl src/events.c > src/events.str /usr/bin/perl tools/build/c2str.pl src/exceptions.c > src/exceptions.str /usr/bin/perl tools/build/c2str.pl src/global.c > src/global.str /usr/bin/perl tools/build/c2str.pl src/global_setup.c > src/global_setup.str /usr/bin/perl tools/build/c2str.pl src/hll.c > src/hll.str /usr/bin/perl tools/build/c2str.pl src/call/pcc.c > src/call/pcc.str /usr/bin/perl tools/build/c2str.pl src/inter_cb.c > src/inter_cb.str /usr/bin/perl tools/build/c2str.pl src/inter_create.c > src/inter_create.str /usr/bin/perl tools/build/c2str.pl src/inter_misc.c > src/inter_misc.str /usr/bin/perl tools/build/c2str.pl src/io/api.c > src/io/api.str /usr/bin/perl tools/build/c2str.pl src/key.c > src/key.str /usr/bin/perl tools/build/c2str.pl src/library.c > src/library.str /usr/bin/perl tools/build/c2str.pl src/multidispatch.c > src/multidispatch.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/nci.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/nci.pmc /usr/bin/perl tools/build/nativecall.pl src/call_list.txt /usr/bin/perl tools/build/c2str.pl src/nci.c > src/nci.str /usr/bin/perl tools/build/c2str.pl src/packfile.c > src/packfile.str /usr/bin/perl tools/build/c2str.pl src/pmc.c > src/pmc.str /usr/bin/perl tools/build/c2str.pl src/pmc_freeze.c > src/pmc_freeze.str /usr/bin/perl tools/build/c2str.pl src/oo.c > src/oo.str /usr/bin/perl tools/build/c2str.pl src/scheduler.c > src/scheduler.str /usr/bin/perl tools/build/c2str.pl src/spf_render.c > src/spf_render.str /usr/bin/perl tools/build/c2str.pl src/spf_vtable.c > src/spf_vtable.str /usr/bin/perl tools/build/c2str.pl src/sub.c > src/sub.str /usr/bin/perl tools/build/c2str.pl src/stacks.c > src/stacks.str /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/default.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/default.c > src/pmc/default.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/null.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/null.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/null.c > src/pmc/null.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/env.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/env.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/env.c > src/pmc/env.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/key.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/key.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/key.c > src/pmc/key.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/random.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/random.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/random.c > src/pmc/random.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/unmanagedstruct.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/unmanagedstruct.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/unmanagedstruct.c > src/pmc/unmanagedstruct.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/managedstruct.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/managedstruct.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/managedstruct.c > src/pmc/managedstruct.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/exception.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/exception.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/exception.c > src/pmc/exception.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/parrotlibrary.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/parrotlibrary.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/parrotlibrary.c > src/pmc/parrotlibrary.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/parrotinterpreter.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/parrotinterpreter.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/parrotinterpreter.c > src/pmc/parrotinterpreter.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/parrotthread.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/parrotthread.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/parrotthread.c > src/pmc/parrotthread.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/lexpad.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/lexpad.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/lexpad.c > src/pmc/lexpad.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/task.pmc /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/timer.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/timer.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/timer.c > src/pmc/timer.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/pointer.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/pointer.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/pointer.c > src/pmc/pointer.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/sub.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/sub.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/sub.c > src/pmc/sub.str /usr/bin/perl tools/build/c2str.pl src/pmc/continuation.c > src/pmc/continuation.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/retcontinuation.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/retcontinuation.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/retcontinuation.c > src/pmc/retcontinuation.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/coroutine.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/coroutine.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/coroutine.c > src/pmc/coroutine.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/eval.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/eval.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/eval.c > src/pmc/eval.str /usr/bin/perl tools/build/c2str.pl src/pmc/nci.c > src/pmc/nci.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/scalar.pmc /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/float.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/float.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/float.c > src/pmc/float.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/integer.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/integer.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/integer.c > src/pmc/integer.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/bigint.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/bigint.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/bigint.c > src/pmc/bigint.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/bignum.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/bignum.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/bignum.c > src/pmc/bignum.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/complex.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/complex.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/complex.c > src/pmc/complex.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/string.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/string.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/string.c > src/pmc/string.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/boolean.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/boolean.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/boolean.c > src/pmc/boolean.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/ref.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/ref.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/ref.c > src/pmc/ref.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/sharedref.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/sharedref.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/sharedref.c > src/pmc/sharedref.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/array.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/array.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/array.c > src/pmc/array.str /usr/bin/perl tools/build/c2str.pl src/pmc/fixedintegerarray.c > src/pmc/fixedintegerarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/iterator.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/iterator.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/iterator.c > src/pmc/iterator.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/fixedstringarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/fixedstringarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/fixedstringarray.c > src/pmc/fixedstringarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/hash.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/hash.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/hash.c > src/pmc/hash.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/orderedhash.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/orderedhash.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/orderedhash.c > src/pmc/orderedhash.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/os.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/os.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/os.c > src/pmc/os.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/file.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/file.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/file.c > src/pmc/file.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/addrregistry.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/addrregistry.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/addrregistry.c > src/pmc/addrregistry.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/bound_nci.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/bound_nci.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/bound_nci.c > src/pmc/bound_nci.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/capture.pmc /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/callsignature.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/callsignature.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/callsignature.c > src/pmc/callsignature.str /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/capture.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/capture.c > src/pmc/capture.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/class.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/class.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/class.c > src/pmc/class.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/codestring.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/codestring.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/codestring.c > src/pmc/codestring.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/cpointer.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/cpointer.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/cpointer.c > src/pmc/cpointer.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/eventhandler.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/eventhandler.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/eventhandler.c > src/pmc/eventhandler.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/exceptionhandler.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/exceptionhandler.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/exceptionhandler.c > src/pmc/exceptionhandler.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/exporter.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/exporter.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/exporter.c > src/pmc/exporter.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/filehandle.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/filehandle.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/filehandle.c > src/pmc/filehandle.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/fixedbooleanarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/fixedbooleanarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/fixedbooleanarray.c > src/pmc/fixedbooleanarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/fixedfloatarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/fixedfloatarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/fixedfloatarray.c > src/pmc/fixedfloatarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/fixedpmcarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/fixedpmcarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/fixedpmcarray.c > src/pmc/fixedpmcarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/lexinfo.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/lexinfo.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/lexinfo.c > src/pmc/lexinfo.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/resizablepmcarray.pmc /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/multisub.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/multisub.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/multisub.c > src/pmc/multisub.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/namespace.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/namespace.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/namespace.c > src/pmc/namespace.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/object.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/object.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/object.c > src/pmc/object.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfile.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfile.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfile.c > src/pmc/packfile.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfileannotation.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfileannotation.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfileannotation.c > src/pmc/packfileannotation.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfileannotationkeys.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfileannotationkeys.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfileannotationkeys.c > src/pmc/packfileannotationkeys.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfilesegment.pmc /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfileannotations.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfileannotations.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfileannotations.c > src/pmc/packfileannotations.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfileconstanttable.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfileconstanttable.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfileconstanttable.c > src/pmc/packfileconstanttable.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfiledirectory.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfiledirectory.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfiledirectory.c > src/pmc/packfiledirectory.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfilefixupentry.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfilefixupentry.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfilefixupentry.c > src/pmc/packfilefixupentry.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfilefixuptable.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfilefixuptable.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfilefixuptable.c > src/pmc/packfilefixuptable.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/packfilerawsegment.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfilerawsegment.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfilerawsegment.c > src/pmc/packfilerawsegment.str /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/packfilesegment.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/packfilesegment.c > src/pmc/packfilesegment.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/parrotrunningthread.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/parrotrunningthread.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/parrotrunningthread.c > src/pmc/parrotrunningthread.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/pccmethod_test.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/pccmethod_test.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/pccmethod_test.c > src/pmc/pccmethod_test.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/pmcproxy.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/pmcproxy.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/pmcproxy.c > src/pmc/pmcproxy.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/resizablebooleanarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/resizablebooleanarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/resizablebooleanarray.c > src/pmc/resizablebooleanarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/resizablefloatarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/resizablefloatarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/resizablefloatarray.c > src/pmc/resizablefloatarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/resizableintegerarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/resizableintegerarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/resizableintegerarray.c > src/pmc/resizableintegerarray.str /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/resizablepmcarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/resizablepmcarray.c > src/pmc/resizablepmcarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/resizablestringarray.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/resizablestringarray.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/resizablestringarray.c > src/pmc/resizablestringarray.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/role.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/role.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/role.c > src/pmc/role.str /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/scalar.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/scalar.c > src/pmc/scalar.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/scheduler.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/scheduler.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/scheduler.c > src/pmc/scheduler.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/schedulermessage.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/schedulermessage.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/schedulermessage.c > src/pmc/schedulermessage.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/slice.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/slice.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/slice.c > src/pmc/slice.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/stringhandle.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/stringhandle.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/stringhandle.c > src/pmc/stringhandle.str /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/task.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/task.c > src/pmc/task.str /usr/bin/perl tools/build/pmc2c.pl --dump src/pmc/undef.pmc /usr/bin/perl tools/build/pmc2c.pl --c src/pmc/undef.pmc /usr/bin/perl tools/build/c2str.pl src/pmc/undef.c > src/pmc/undef.str /usr/bin/perl tools/build/c2str.pl --all src/string/api.c In file included from src/string/api.c:29: src/string/private_cstring.h:21: warning: size of 'parrot_cstrings' is 9588 bytes src/string/api.c: In function 'Parrot_str_to_num': src/string/api.c:2089: warning: unused variable '__ptr_u' src/ops/core_ops.c src/ops/core_ops.c:168: warning: size of 'core_op_info_table' is 55836 bytes src/ops/core_ops.c:16662: warning: size of 'core_op_func_table' is 5076 bytes src/ops/core.ops: In function 'Parrot_end': src/ops/core_ops.c:17959: warning: unused parameter 'cur_opcode' src/ops/core_ops.c:17959: warning: unused parameter 'interp' src/ops/core.ops: In function 'Parrot_noop': src/ops/core.ops:57: warning: unused parameter 'interp' src/ops/core.ops: In function 'Parrot_reserved_ic': src/ops/core.ops:161: warning: unused parameter 'interp' src/ops/core.ops: In function 'Parrot_branch_ic': src/ops/core.ops:195: warning: unused parameter 'interp' src/ops/core.ops: In function 'Parrot_ret': src/ops/core.ops:240: warning: unused parameter 'cur_opcode' src/ops/core.ops: In function 'Parrot_jump_ic': src/ops/core.ops:341: warning: unused parameter 'interp' src/ops/object.ops: In function 'Parrot_pic_infix___ic_p_p': src/ops/object.ops:532: warning: unused parameter 'cur_opcode' src/ops/object.ops: In function 'Parrot_pic_inline_sub___ic_p_p': src/ops/object.ops:537: warning: unused parameter 'cur_opcode' src/ops/object.ops: In function 'Parrot_pic_get_params___pc': src/ops/object.ops:542: warning: unused parameter 'cur_opcode' src/ops/object.ops: In function 'Parrot_pic_set_returns___pc': src/ops/object.ops:547: warning: unused parameter 'cur_opcode' src/ops/object.ops: In function 'Parrot_pic_callr___pc': src/ops/object.ops:552: warning: unused parameter 'cur_opcode' src/ops/experimental.ops: In function 'Parrot_gcd_i_n_n': src/ops/experimental.ops:52: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_gcd_i_nc_n': src/ops/experimental.ops:52: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_gcd_i_n_nc': src/ops/experimental.ops:52: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_gcd_i_nc_nc': src/ops/experimental.ops:52: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_gcd_i_i_i_i_i': src/ops/experimental.ops:69: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_gcd_i_i_i_ic_i': src/ops/experimental.ops:69: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_gcd_i_i_i_i_ic': src/ops/experimental.ops:69: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_gcd_i_i_i_ic_ic': src/ops/experimental.ops:69: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_exec_s': src/ops/experimental.ops:148: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_exec_sc': src/ops/experimental.ops:148: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_classname_p_p': src/ops/experimental.ops:160: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_trap': src/ops/experimental.ops:207: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_need_finalize_p': src/ops/experimental.ops:224: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_runinterp_p_p': src/ops/experimental.ops:239: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_runinterp_p_pc': src/ops/experimental.ops:239: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_substr_r_s_s_i_i': src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_substr_r_s_sc_i_i': src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_substr_r_s_s_ic_i': src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_substr_r_s_sc_ic_i': src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_substr_r_s_s_i_ic': src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_substr_r_s_sc_i_ic': src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_substr_r_s_s_ic_ic': src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops: In function 'Parrot_substr_r_s_sc_ic_ic': src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/core_ops_switch.c src/byteorder.c src/string/charset.c src/string/charset.c: In function 'register_charset': src/string/charset.c:326: warning: unused parameter 'interp' src/core_pmcs.c src/datatypes.c src/datatypes.c: In function 'floatval_divide_by_zero': src/datatypes.c:87: warning: unused parameter 'interp' src/debug.c src/debug.c: In function 'PDB_disassemble_op': src/debug.c:2499: warning: unused parameter 'space' src/debug.c: At top level: src/debug.c:3289: warning: 'dump_string' defined but not used src/debug.c:3671: warning: 'GDB_B' defined but not used src/debug.c:716: warning: 'nextarg' defined but not used src/debug.c:847: warning: 'parse_key' defined but not used src/debug.c:747: warning: 'skip_command' defined but not used src/dynext.c src/embed.c src/embed.c: In function 'Parrot_disassemble': src/embed.c:1158: warning: unused parameter 'outfile' src/embed.c: In function 'Parrot_compile_string': src/embed.c:1296: warning: unused variable 'pf' src/string/encoding.c src/string/encoding.c: In function 'register_encoding': src/string/encoding.c:294: warning: unused parameter 'interp' src/events.c src/exceptions.c src/exit.c src/extend.c src/extend.c: In function 'Parrot_PMC_newclass': src/extend.c:1502: warning: unused variable 'hll' src/extend.c:1501: warning: unused variable 'hllns' src/extend_vtable.c src/gc/api.c src/gc/generational_ms.c src/gc/incremental_ms.c src/gc/incremental_ms.c: In function 'Parrot_gc_ims_wb': src/gc/incremental_ms.c:1123: warning: unused parameter 'agg' src/gc/memory.c src/gc/pools.c src/gc/register.c src/gc/mark_sweep.c src/gc/system.c src/global.c src/global_setup.c src/hash.c src/hash.c: In function 'parrot_hash_size': src/hash.c:1176: warning: unused parameter 'interp' src/hll.c src/call/pcc.c src/inter_cb.c src/inter_create.c src/inter_misc.c src/interpreter.c src/interpreter.c: In function 'dynop_register_xx': src/interpreter.c:1184: warning: unused variable 'lib_variant' src/interpreter.c:1183: warning: unused variable 'new_init_func' src/interpreter.c:1176: warning: unused variable 'new_lib' src/call/ops.c src/key.c src/key.c: In function 'key_new_pmc': src/key.c:163: warning: unused parameter 'value' src/key.c: In function 'key_set_number': src/key.c:231: warning: unused parameter 'interp' src/key.c: In function 'key_set_pmc': src/key.c:277: warning: unused parameter 'value' src/library.c src/library.c:32: warning: 'cnv_to_win32_filesep' declared 'static' but never defined src/list.c src/longopt.c src/misc.c src/misc.c: In function 'Parrot_secret_snprintf': src/misc.c:251: warning: unused parameter 'len' src/multidispatch.c src/multidispatch.c:615: warning: 'distance_cmp' defined but not used src/multidispatch.c:560: warning: 'Parrot_mmd_search_classes' defined but not used src/multidispatch.c:1078: warning: 'Parrot_mmd_search_scopes' defined but not used src/nci.c src/nci.c: In function 'build_call_func': src/nci.c:6401: warning: unused variable 'jit_key_name' src/nci.c:6397: warning: unused parameter 'jitted' src/oo.c src/oo.c:40: warning: 'debug_trace_find_meth' declared 'static' but never defined src/packfile.c src/packfile.c: In function 'PackFile_Annotations_new': src/packfile.c:4036: warning: unused parameter 'interp' src/packfile.c:4036: warning: unused parameter 'pf' src/packfile.c: In function 'PackFile_Annotations_packed_size': src/packfile.c:4101: warning: unused parameter 'interp' src/packfile.c: In function 'PackFile_Annotations_pack': src/packfile.c:4124: warning: unused parameter 'interp' src/packfile.c: In function 'PackFile_Annotations_add_group': src/packfile.c:4327: warning: unused parameter 'interp' src/packout.c src/pic_jit.c src/pic_jit.c:86: warning: 'pic_test_func' declared 'static' but never defined src/pic.c src/pic.c: In function 'parrot_pic_find_infix_v_pp': src/pic.c:968: warning: unused parameter 'interp' src/pic.c:968: warning: unused parameter 'left' src/pic.c:968: warning: unused parameter 'right' src/pic.c:969: warning: unused parameter 'mic' src/pic.c:969: warning: unused parameter 'cur_opcode' src/pic.c: At top level: src/pic.c:933: warning: 'parrot_pic_move' defined but not used src/platform.c config/gen/platform/generic/stat.c: In function 'Parrot_stat_file': config/gen/platform/generic/stat.c:37: warning: unused parameter 'interp' config/gen/platform/generic/stat.c:37: warning: unused parameter 'filename' config/gen/platform/generic/stat.c: In function 'Parrot_stat_info_pmc': config/gen/platform/generic/stat.c:54: warning: unused parameter 'interp' config/gen/platform/generic/stat.c:54: warning: unused parameter 'filename' config/gen/platform/generic/stat.c:54: warning: unused parameter 'thing' config/gen/platform/generic/stat.c: In function 'Parrot_stat_info_floatval': config/gen/platform/generic/stat.c:205: warning: unused parameter 'interp' config/gen/platform/generic/stat.c:205: warning: unused parameter 'filename' config/gen/platform/generic/stat.c:205: warning: unused parameter 'thing' config/gen/platform/generic/stat.c: In function 'Parrot_stat_info_string': config/gen/platform/generic/stat.c:222: warning: unused parameter 'interp' config/gen/platform/generic/stat.c:222: warning: unused parameter 'filename' config/gen/platform/generic/stat.c:222: warning: unused parameter 'thing' config/gen/platform/generic/itimer.c: In function 'start_sys_timer_ms': config/gen/platform/generic/itimer.c:41: warning: unused parameter 'handle' config/gen/platform/generic/itimer.c: In function 'get_sys_timer_ms': config/gen/platform/generic/itimer.c:80: warning: unused parameter 'handle' src/pmc_freeze.c src/pmc_freeze.c:975: warning: 'pmc_add_ext' defined but not used src/pmc_freeze.c:514: warning: 'push_ascii_integer' defined but not used src/pmc_freeze.c:534: warning: 'push_ascii_number' defined but not used src/pmc_freeze.c:589: warning: 'push_ascii_pmc' defined but not used src/pmc_freeze.c:558: warning: 'push_ascii_string' defined but not used src/pmc_freeze.c:608: warning: 'shift_ascii_integer' defined but not used src/pmc_freeze.c:634: warning: 'shift_ascii_number' defined but not used src/pmc_freeze.c:695: warning: 'shift_ascii_pmc' defined but not used src/pmc_freeze.c:662: warning: 'shift_ascii_string' defined but not used src/pmc.c src/pmc.c:512: warning: 'pmc_free' defined but not used src/runops_cores.c src/scheduler.c src/scheduler.c: In function 'Parrot_cx_send_message': src/scheduler.c:721: warning: unused parameter 'payload' src/spf_render.c src/spf_vtable.c src/stacks.c src/string/primitives.c src/sub.c src/sub.c: In function 'Parrot_Context_get_info': src/sub.c:414: warning: unused variable '__ptr_u' src/sub.c: In function 'Parrot_Context_infostr': src/sub.c:513: warning: unused variable '__ptr_u' src/sub.c: In function 'Parrot_capture_lex': src/sub.c:582: warning: unused variable 'outer_sub' src/thread.c src/thread.c: In function 'get_pool': src/thread.c:235: warning: unused parameter 'interp' src/thread.c: In function 'pt_free_pool': src/thread.c:253: warning: unused parameter 'interp' src/thread.c: In function 'pt_thread_signal': src/thread.c:375: warning: unused parameter 'self' src/thread.c: In function 'pt_thread_prepare_for_run': src/thread.c:678: warning: unused parameter 's' src/thread.c: In function 'pt_gc_count_threads': src/thread.c:1028: warning: unused parameter 'interp' src/thread.c: In function 'pt_gc_mark_root_finished': src/thread.c:1710: warning: unused parameter 'interp' src/thread.c: At top level: src/thread.c:974: warning: 'remove_queued_suspend_gc' defined but not used src/trace.c src/tsq.c src/utils.c src/vtables.c src/warnings.c src/packfile/pf_items.c src/packfile/pf_items.c:42: warning: 'cvt_num12_num16' declared 'static' but never defined src/packfile/pf_items.c:49: warning: 'cvt_num12_num16_le' declared 'static' but never defined src/packfile/pf_items.c:70: warning: 'cvt_num16_num12' declared 'static' but never defined src/packfile/pf_items.c:77: warning: 'cvt_num16_num12_be' declared 'static' but never defined src/packfile/pf_items.c:91: warning: 'cvt_num16_num8_be' declared 'static' but never defined src/packfile/pf_items.c:105: warning: 'cvt_num8_num12' declared 'static' but never defined src/packfile/pf_items.c:112: warning: 'cvt_num8_num12_be' declared 'static' but never defined src/packfile/pf_items.c:119: warning: 'cvt_num8_num16' declared 'static' but never defined src/packfile/pf_items.c:126: warning: 'cvt_num8_num16_be' declared 'static' but never defined src/packfile/pf_items.c:133: warning: 'cvt_num8_num16_le' declared 'static' but never defined src/packfile/pf_items.c:157: warning: 'fetch_op_mixed_be' declared 'static' but never defined src/packfile/pf_items.c:161: warning: 'fetch_op_mixed_le' declared 'static' but never defined src/ops/core_ops_cg.c src/ops/core_ops_cg.c: In function 'cg_core': src/ops/core_ops_cg.c:190: warning: size of 'l_ops_addr' is 5076 bytes src/ops/core_ops_cgp.c src/ops/core_ops_cgp.c: In function 'cgp_core': src/ops/core_ops_cgp.c:201: warning: size of 'l_ops_addr' is 5076 bytes src/ops/experimental.ops:52: warning: unused variable 'unused' src/ops/experimental.ops:52: warning: unused variable 'unused' src/ops/experimental.ops:52: warning: unused variable 'unused' src/ops/experimental.ops:52: warning: unused variable 'unused' src/ops/experimental.ops:69: warning: unused variable 'unused' src/ops/experimental.ops:69: warning: unused variable 'unused' src/ops/experimental.ops:69: warning: unused variable 'unused' src/ops/experimental.ops:69: warning: unused variable 'unused' src/ops/experimental.ops:148: warning: unused variable 'unused' src/ops/experimental.ops:148: warning: unused variable 'unused' src/ops/experimental.ops:160: warning: unused variable 'unused' src/ops/experimental.ops:207: warning: unused variable 'unused' src/ops/experimental.ops:224: warning: unused variable 'unused' src/ops/experimental.ops:239: warning: unused variable 'unused' src/ops/experimental.ops:239: warning: unused variable 'unused' src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops:265: warning: unused variable 'unused' src/ops/experimental.ops:265: warning: unused variable 'unused' /usr/bin/perl -MExtUtils::Command -e cp src/jit/ppc/exec_dep.h src/exec_dep.h /usr/bin/perl -MExtUtils::Command -e cp src/jit/ppc/jit_emit.h src/jit_emit.h src/exec.c In file included from src/exec.c:26: src/jit_emit.h: In function 'jit_set_args_pc': src/jit_emit.h:974: warning: unused variable 'reg_info' src/jit_emit.h: In function 'jit_save_regs_call': src/jit_emit.h:1032: warning: unused variable 'save_i' src/jit_emit.h: In function 'jit_restore_regs_call': src/jit_emit.h:1056: warning: unused variable 'save_i' src/exec.c: In function 'Parrot_exec': src/exec.c:86: warning: unused parameter 'pc' src/exec.c: At top level: src/jit_emit.h:583: warning: 'jit_emit_bc' defined but not used src/jit_emit.h:612: warning: 'jit_emit_bx' defined but not used src/jit_emit.h:737: warning: 'fdiv_rrr' defined but not used src/jit_emit.h:775: warning: 'cmod_rrr' defined but not used src/jit_emit.h:880: warning: 'jit_get_params_pc' defined but not used src/jit_emit.h:907: warning: 'jit_set_returns_pc' defined but not used src/jit_emit.h:967: warning: 'jit_set_args_pc' defined but not used src/jit_emit.h:1054: warning: 'jit_restore_regs_call' defined but not used /usr/bin/perl tools/build/jit2c.pl ppc src/exec_cpu.c jit2c: JITed 144 (+ 205 vtable) of 1268 ops src/exec_cpu.c In file included from src/exec_cpu.c:51: src/jit_emit.h: In function 'jit_set_args_pc': src/jit_emit.h:974: warning: unused variable 'reg_info' src/jit_emit.h: In function 'jit_save_regs_call': src/jit_emit.h:1032: warning: unused variable 'save_i' src/jit_emit.h: In function 'jit_restore_regs_call': src/jit_emit.h:1056: warning: unused variable 'save_i' src/jit/ppc/core.jit: In function 'Parrot_end_exec': src/exec_cpu.c:72: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_noop_exec': src/jit/ppc/core.jit:19: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_branch_i_exec': src/jit/ppc/core.jit:26: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_branch_ic_exec': src/jit/ppc/core.jit:1184: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_if_i_ic_exec': src/jit/ppc/core.jit:1178: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_if_n_ic_exec': src/jit/ppc/core.jit:944: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_unless_i_ic_exec': src/jit/ppc/core.jit:966: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_unless_n_ic_exec': src/jit/ppc/core.jit:944: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_i_exec': src/jit/ppc/core.jit:1244: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_i_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_ic_i_exec': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_i_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_i_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_ic_i_exec': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shl_i_i_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shl_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shl_i_ic_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shl_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shr_i_i_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shr_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shr_i_ic_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shr_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lsr_i_i_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lsr_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lsr_i_ic_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lsr_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_rot_i_i_ic_ic_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_i_exec': src/jit/ppc/core.jit:700: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_i_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_ic_i_exec': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_i_i_ic_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_ic_i_ic_exec': src/jit/ppc/core.jit:994: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_i_ic_ic_exec': src/jit/ppc/core.jit:1023: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_n_n_ic_exec': src/jit/ppc/core.jit:1008: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_nc_n_ic_exec': src/jit/ppc/core.jit:1096: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_i_i_ic_exec': src/jit/ppc/core.jit:1108: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_ic_i_ic_exec': src/jit/ppc/core.jit:994: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_i_ic_ic_exec': src/jit/ppc/core.jit:1023: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_n_n_ic_exec': src/jit/ppc/core.jit:1008: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_nc_n_ic_exec': src/jit/ppc/core.jit:1096: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_i_i_ic_exec': src/jit/ppc/core.jit:1108: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_ic_i_ic_exec': src/jit/ppc/core.jit:994: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_i_ic_ic_exec': src/jit/ppc/core.jit:1023: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_n_n_ic_exec': src/jit/ppc/core.jit:1008: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_nc_n_ic_exec': src/jit/ppc/core.jit:1096: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_i_i_ic_exec': src/jit/ppc/core.jit:1108: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_ic_i_ic_exec': src/jit/ppc/core.jit:994: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_i_ic_ic_exec': src/jit/ppc/core.jit:1023: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_n_n_ic_exec': src/jit/ppc/core.jit:1008: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_nc_n_ic_exec': src/jit/ppc/core.jit:1096: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmp_i_i_i_exec': src/jit/ppc/core.jit:1108: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmp_i_n_n_exec': src/jit/ppc/core.jit:799: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_isle_i_i_i_exec': src/jit/ppc/core.jit:799: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_isle_i_n_n_exec': src/jit/ppc/core.jit:763: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_islt_i_i_i_exec': src/jit/ppc/core.jit:763: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_islt_i_n_n_exec': src/jit/ppc/core.jit:731: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_iseq_i_i_i_exec': src/jit/ppc/core.jit:731: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_iseq_i_n_n_exec': src/jit/ppc/core.jit:731: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_abs_i_exec': src/jit/ppc/core.jit:731: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_abs_n_exec': src/jit/ppc/core.jit:928: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_abs_n_n_exec': src/jit/ppc/core.jit:892: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_i_i_exec': src/jit/ppc/core.jit:187: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_i_ic_exec': src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_n_n_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_n_nc_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit: In function 'Parrot_add_i_i_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_i_ic_i_exec': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_n_n_n_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmod_i_i_i_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmod_i_ic_i_exec': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmod_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_dec_i_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_dec_n_exec': src/jit/ppc/core.jit:852: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_i_i_exec': src/jit/ppc/core.jit:880: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_n_n_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_n_nc_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit: In function 'Parrot_div_i_i_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_i_ic_i_exec': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_n_n_n_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_inc_i_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_inc_n_exec': src/jit/ppc/core.jit:841: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_i_i_exec': src/jit/ppc/core.jit:866: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_n_n_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_n_nc_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit: In function 'Parrot_mul_i_i_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_i_ic_i_exec': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_n_n_n_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_neg_i_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_neg_n_exec': src/jit/ppc/core.jit:892: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_neg_i_i_exec': src/jit/ppc/core.jit:892: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_neg_n_n_exec': src/jit/ppc/core.jit:187: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_i_i_exec': src/jit/ppc/core.jit:187: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_i_ic_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_n_n_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_n_nc_exec': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit: In function 'Parrot_sub_i_i_i_exec': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_i_ic_i_exec': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_i_i_ic_exec': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_n_n_n_exec': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_i_i_exec': src/jit/ppc/core.jit:1191: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_i_ic_exec': src/jit/ppc/core.jit:128: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_i_n_exec': src/jit/ppc/core.jit:37: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_n_n_exec': src/jit/ppc/core.jit:56: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_n_nc_exec': src/jit/ppc/core.jit:156: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_n_i_exec': src/jit/ppc/core.jit:168: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_n_ic_exec': src/jit/ppc/core.jit:103: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_null_i_exec': src/jit/ppc/core.jit:128: warning: unused parameter 'interp' src/jit/ppc/core.jit: At top level: src/jit/ppc/core.jit:110: warning: size of 'op_exec' is 10144 bytes src/jit/ppc/core.jit:110: warning: size of 'op_exec' is 10144 bytes /usr/bin/perl -MExtUtils::Command -e cp src/jit/ppc/exec_dep.c src/exec_dep.c src/exec_dep.c In file included from src/exec_dep.c:20: src/jit_emit.h: In function 'jit_set_args_pc': src/jit_emit.h:974: warning: unused variable 'reg_info' src/jit_emit.h: In function 'jit_save_regs_call': src/jit_emit.h:1032: warning: unused variable 'save_i' src/jit_emit.h: In function 'jit_restore_regs_call': src/jit_emit.h:1056: warning: unused variable 'save_i' src/exec_dep.c: In function 'Parrot_exec_restart_op': src/exec_dep.c:61: warning: unused parameter 'jit_info' src/exec_dep.c:61: warning: unused parameter 'interp' src/exec_dep.c: At top level: src/jit_emit.h:583: warning: 'jit_emit_bc' defined but not used src/jit_emit.h:612: warning: 'jit_emit_bx' defined but not used src/jit_emit.h:737: warning: 'fdiv_rrr' defined but not used src/jit_emit.h:775: warning: 'cmod_rrr' defined but not used src/jit_emit.h:880: warning: 'jit_get_params_pc' defined but not used src/jit_emit.h:907: warning: 'jit_set_returns_pc' defined but not used src/jit_emit.h:967: warning: 'jit_set_args_pc' defined but not used src/jit_emit.h:1054: warning: 'jit_restore_regs_call' defined but not used src/exec_save.c src/exec_save.c: In function 'Parrot_exec_save': src/exec_save.c:200: warning: unused variable 'rellocation' src/exec_save.c: At top level: src/exec_save.c:763: warning: 'save_int' defined but not used src/exec_save.c:780: warning: 'save_short' defined but not used src/jit.c In file included from src/jit.c:34: src/jit_emit.h: In function 'jit_set_args_pc': src/jit_emit.h:974: warning: unused variable 'reg_info' src/jit_emit.h: In function 'jit_save_regs_call': src/jit_emit.h:1032: warning: unused variable 'save_i' src/jit_emit.h: In function 'jit_restore_regs_call': src/jit_emit.h:1056: warning: unused variable 'save_i' src/jit_emit.h: In function 'Parrot_jit_begin': src/jit_emit.h:1084: warning: unused parameter 'interp' src/jit_emit.h: In function 'Parrot_jit_begin_sub': src/jit_emit.h:1120: warning: unused parameter 'jit_info' src/jit_emit.h:1121: warning: unused parameter 'interp' src/jit_emit.h: In function 'Parrot_jit_dofixup': src/jit_emit.h:1170: warning: unused variable 'low' src/jit_emit.h:1170: warning: unused variable 'high' src/jit_emit.h:1169: warning: unused variable 'disp' src/jit_emit.h:1165: warning: unused parameter 'interp' src/jit_emit.h: In function 'jit_mov_mr_offs': src/jit_emit.h:1217: warning: unused parameter 'interp' src/jit_emit.h:1217: warning: unused parameter 'base' src/jit_emit.h: In function 'jit_mov_rm_offs': src/jit_emit.h:1231: warning: unused parameter 'interp' src/jit_emit.h:1231: warning: unused parameter 'base' src/jit_emit.h: In function 'jit_mov_mr_n_offs': src/jit_emit.h:1239: warning: unused parameter 'interp' src/jit_emit.h:1239: warning: unused parameter 'base' src/jit_emit.h: In function 'jit_mov_rm_n_offs': src/jit_emit.h:1248: warning: unused parameter 'interp' src/jit_emit.h:1249: warning: unused parameter 'base' src/jit_emit.h: In function 'ppc_flush_cache': src/jit_emit.h:1344: warning: unused parameter 'interp' src/jit_emit.h: At top level: src/jit_emit.h:1390: warning: no previous prototype for 'Parrot_jit_init' src/jit_emit.h: In function 'Parrot_jit_init': src/jit_emit.h:1390: warning: unused parameter 'interp' src/jit.c: At top level: src/jit_emit.h:583: warning: 'jit_emit_bc' defined but not used src/jit_emit.h:612: warning: 'jit_emit_bx' defined but not used src/jit_emit.h:737: warning: 'fdiv_rrr' defined but not used src/jit_emit.h:775: warning: 'cmod_rrr' defined but not used src/jit_emit.h:907: warning: 'jit_set_returns_pc' defined but not used src/jit_emit.h:967: warning: 'jit_set_args_pc' defined but not used src/jit_emit.h:1054: warning: 'jit_restore_regs_call' defined but not used src/jit.c:1001: warning: 'optimize_imcc_jit' defined but not used /usr/bin/perl tools/build/jit2c.pl ppc src/jit_cpu.c jit2c: JITed 144 (+ 205 vtable) of 1268 ops src/jit_cpu.c In file included from src/jit_cpu.c:51: src/jit_emit.h: In function 'jit_set_args_pc': src/jit_emit.h:974: warning: unused variable 'reg_info' src/jit_emit.h: In function 'jit_save_regs_call': src/jit_emit.h:1032: warning: unused variable 'save_i' src/jit_emit.h: In function 'jit_restore_regs_call': src/jit_emit.h:1056: warning: unused variable 'save_i' src/jit/ppc/core.jit: In function 'Parrot_end_jit': src/jit_cpu.c:71: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_noop_jit': src/jit/ppc/core.jit:19: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_branch_i_jit': src/jit/ppc/core.jit:26: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_branch_ic_jit': src/jit/ppc/core.jit:1184: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_if_i_ic_jit': src/jit/ppc/core.jit:1178: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_if_n_ic_jit': src/jit/ppc/core.jit:944: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_unless_i_ic_jit': src/jit/ppc/core.jit:966: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_unless_n_ic_jit': src/jit/ppc/core.jit:944: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_i_jit': src/jit/ppc/core.jit:1244: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_i_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_ic_i_jit': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_band_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_i_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_i_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_ic_i_jit': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bor_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shl_i_i_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shl_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shl_i_ic_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shl_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shr_i_i_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shr_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shr_i_ic_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_shr_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lsr_i_i_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lsr_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lsr_i_ic_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lsr_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_rot_i_i_ic_ic_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_i_jit': src/jit/ppc/core.jit:700: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_i_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_ic_i_jit': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_bxor_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_i_i_ic_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_ic_i_ic_jit': src/jit/ppc/core.jit:994: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_i_ic_ic_jit': src/jit/ppc/core.jit:1023: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_eq_n_n_ic_jit': src/jit/ppc/core.jit:1008: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_i_i_ic_jit': src/jit/ppc/core.jit:1108: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_ic_i_ic_jit': src/jit/ppc/core.jit:994: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_i_ic_ic_jit': src/jit/ppc/core.jit:1023: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_ne_n_n_ic_jit': src/jit/ppc/core.jit:1008: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_i_i_ic_jit': src/jit/ppc/core.jit:1108: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_ic_i_ic_jit': src/jit/ppc/core.jit:994: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_i_ic_ic_jit': src/jit/ppc/core.jit:1023: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_lt_n_n_ic_jit': src/jit/ppc/core.jit:1008: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_i_i_ic_jit': src/jit/ppc/core.jit:1108: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_ic_i_ic_jit': src/jit/ppc/core.jit:994: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_i_ic_ic_jit': src/jit/ppc/core.jit:1023: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_le_n_n_ic_jit': src/jit/ppc/core.jit:1008: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmp_i_i_i_jit': src/jit/ppc/core.jit:1108: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmp_i_n_n_jit': src/jit/ppc/core.jit:799: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_isle_i_i_i_jit': src/jit/ppc/core.jit:799: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_isle_i_n_n_jit': src/jit/ppc/core.jit:763: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_islt_i_i_i_jit': src/jit/ppc/core.jit:763: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_islt_i_n_n_jit': src/jit/ppc/core.jit:731: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_iseq_i_i_i_jit': src/jit/ppc/core.jit:731: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_iseq_i_n_n_jit': src/jit/ppc/core.jit:731: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_abs_i_jit': src/jit/ppc/core.jit:731: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_abs_n_jit': src/jit/ppc/core.jit:928: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_abs_n_n_jit': src/jit/ppc/core.jit:892: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_i_i_jit': src/jit/ppc/core.jit:187: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_i_ic_jit': src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_n_n_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_n_nc_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit: In function 'Parrot_add_i_i_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_i_ic_i_jit': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_add_n_n_n_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmod_i_i_i_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmod_i_ic_i_jit': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_cmod_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_dec_i_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_dec_n_jit': src/jit/ppc/core.jit:852: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_i_i_jit': src/jit/ppc/core.jit:880: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_n_n_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_n_nc_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit: In function 'Parrot_div_i_i_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_i_ic_i_jit': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_div_n_n_n_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_inc_i_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_inc_n_jit': src/jit/ppc/core.jit:841: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_i_i_jit': src/jit/ppc/core.jit:866: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_n_n_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_n_nc_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit: In function 'Parrot_mul_i_i_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_i_ic_i_jit': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_mul_n_n_n_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_neg_i_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_neg_n_jit': src/jit/ppc/core.jit:892: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_neg_i_i_jit': src/jit/ppc/core.jit:892: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_neg_n_n_jit': src/jit/ppc/core.jit:187: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_i_i_jit': src/jit/ppc/core.jit:187: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_i_ic_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit:277: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_n_n_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_n_nc_jit': src/jit/ppc/core.jit:207: warning: unused variable 'im' src/jit/ppc/core.jit: In function 'Parrot_sub_i_i_i_jit': src/jit/ppc/core.jit:248: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_i_ic_i_jit': src/jit/ppc/core.jit:316: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_i_i_ic_jit': src/jit/ppc/core.jit:339: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_sub_n_n_n_jit': src/jit/ppc/core.jit:379: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_i_i_jit': src/jit/ppc/core.jit:1191: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_i_ic_jit': src/jit/ppc/core.jit:128: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_i_n_jit': src/jit/ppc/core.jit:37: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_n_n_jit': src/jit/ppc/core.jit:56: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_n_i_jit': src/jit/ppc/core.jit:168: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_set_n_ic_jit': src/jit/ppc/core.jit:103: warning: unused parameter 'interp' src/jit/ppc/core.jit: In function 'Parrot_null_i_jit': src/jit/ppc/core.jit:128: warning: unused parameter 'interp' src/jit/ppc/core.jit: At top level: src/jit/ppc/core.jit:110: warning: size of '_op_jit' is 10144 bytes src/jit_debug.c src/jit_debug_xcoff.c /usr/bin/perl -MExtUtils::Command -e cp src/jit/ppc/jit_defs.c src/jit_defs.c src/jit_defs.c src/gc/resources.c src/gc/resources.c:66: warning: 'buffer_location' declared 'static' but never defined src/gc/resources.c:75: warning: 'debug_print_buf' declared 'static' but never defined src/string/charset/ascii.c src/string/charset/ascii.c:303: warning: 'to_unicode' defined but not used src/string/charset/binary.c src/string/charset/iso-8859-1.c src/string/charset/iso-8859-1.c:257: warning: 'to_unicode' defined but not used src/string/charset/tables.c src/string/charset/unicode.c src/string/charset/unicode.c: In function 'cs_rindex': src/string/charset/unicode.c:744: warning: unused parameter 'offset' src/string/charset/unicode.c: In function 'u_iscclass': src/string/charset/unicode.c:794: warning: unused parameter 'interp' src/io/core.c src/io/api.c src/io/utf8.c src/io/buffer.c src/io/unix.c src/io/win32.c src/io/portable.c src/io/filehandle.c src/pmc/default.c ./src/pmc/default.c: In function 'Parrot_default_absolute': ./src/pmc/default.c:287: warning: unused parameter 'dest' ./src/pmc/default.c: In function 'Parrot_default_add_attribute': ./src/pmc/default.c:304: warning: unused parameter 'name' ./src/pmc/default.c:304: warning: unused parameter 'type' ./src/pmc/default.c: In function 'Parrot_default_add_parent': ./src/pmc/default.c:342: warning: unused parameter 'parent' ./src/pmc/default.c: In function 'Parrot_default_add_role': ./src/pmc/default.c:355: warning: unused parameter 'role' ./src/pmc/default.c: In function 'Parrot_default_add_vtable_override': ./src/pmc/default.c:361: warning: unused parameter 'vtable_name' ./src/pmc/default.c:361: warning: unused parameter 'sub_pmc' ./src/pmc/default.c: In function 'Parrot_default_bitwise_not': ./src/pmc/default.c:454: warning: unused parameter 'dest' ./src/pmc/default.c: In function 'Parrot_default_bitwise_nots': ./src/pmc/default.c:460: warning: unused parameter 'dest' ./src/pmc/default.c: In function 'Parrot_default_clone_pmc': ./src/pmc/default.c:614: warning: unused parameter 'args' ./src/pmc/default.c: In function 'Parrot_default_defined': ./src/pmc/default.c:708: warning: unused parameter 'interp' ./src/pmc/default.c:708: warning: unused parameter 'pmc' ./src/pmc/default.c: In function 'Parrot_default_defined_keyed': ./src/pmc/default.c:716: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_defined_keyed_str': ./src/pmc/default.c:731: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_delete_keyed': ./src/pmc/default.c:737: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_delete_keyed_str': ./src/pmc/default.c:752: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_does_pmc': ./src/pmc/default.c:814: warning: unused parameter 'interp' ./src/pmc/default.c:814: warning: unused parameter 'pmc' ./src/pmc/default.c:814: warning: unused parameter 'role' ./src/pmc/default.c: In function 'Parrot_default_exists_keyed': ./src/pmc/default.c:829: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_exists_keyed_str': ./src/pmc/default.c:844: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_freeze': ./src/pmc/default.c:891: warning: unused parameter 'interp' ./src/pmc/default.c:891: warning: unused parameter 'pmc' ./src/pmc/default.c:891: warning: unused parameter 'info' ./src/pmc/default.c: In function 'Parrot_default_get_attr_keyed': ./src/pmc/default.c:899: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_integer_keyed': ./src/pmc/default.c:977: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_integer_keyed_str': ./src/pmc/default.c:992: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_namespace': ./src/pmc/default.c:1004: warning: unused parameter 'interp' ./src/pmc/default.c: In function 'Parrot_default_get_number_keyed': ./src/pmc/default.c:1018: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_number_keyed_str': ./src/pmc/default.c:1033: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_pmc_keyed': ./src/pmc/default.c:1045: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_pmc_keyed_str': ./src/pmc/default.c:1060: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_pointer': ./src/pmc/default.c:1066: warning: unused parameter 'interp' ./src/pmc/default.c: In function 'Parrot_default_get_pointer_keyed': ./src/pmc/default.c:1074: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_pointer_keyed_int': ./src/pmc/default.c:1080: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_pointer_keyed_str': ./src/pmc/default.c:1086: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_string_keyed': ./src/pmc/default.c:1104: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_get_string_keyed_str': ./src/pmc/default.c:1119: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_init': ./src/pmc/default.c:1577: warning: unused parameter 'interp' ./src/pmc/default.c:1577: warning: unused parameter 'pmc' ./src/pmc/default.c: In function 'Parrot_default_instantiate_str': ./src/pmc/default.c:1649: warning: unused parameter 'rep' ./src/pmc/default.c:1649: warning: unused parameter 'flags' ./src/pmc/default.c: In function 'Parrot_default_invoke': ./src/pmc/default.c:1655: warning: unused parameter 'next' ./src/pmc/default.c: In function 'Parrot_default_is_same': ./src/pmc/default.c:1697: warning: unused parameter 'interp' ./src/pmc/default.c: In function 'Parrot_default_logical_not': ./src/pmc/default.c:1739: warning: unused parameter 'dest' ./src/pmc/default.c: In function 'Parrot_default_mark': ./src/pmc/default.c:1767: warning: unused parameter 'pmc' ./src/pmc/default.c: In function 'Parrot_default_name': ./src/pmc/default.c:1849: warning: unused parameter 'interp' ./src/pmc/default.c: In function 'Parrot_default_neg': ./src/pmc/default.c:1857: warning: unused parameter 'dest' ./src/pmc/default.c: In function 'Parrot_default_nextkey_keyed': ./src/pmc/default.c:1863: warning: unused parameter 'key' ./src/pmc/default.c:1863: warning: unused parameter 'what' ./src/pmc/default.c: In function 'Parrot_default_nextkey_keyed_str': ./src/pmc/default.c:1878: warning: unused parameter 'key' ./src/pmc/default.c:1878: warning: unused parameter 'what' ./src/pmc/default.c: In function 'Parrot_default_push_float': ./src/pmc/default.c:1941: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_push_integer': ./src/pmc/default.c:1947: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_push_pmc': ./src/pmc/default.c:1953: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_push_string': ./src/pmc/default.c:1959: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_remove_attribute': ./src/pmc/default.c:1965: warning: unused parameter 'name' ./src/pmc/default.c: In function 'Parrot_default_remove_method': ./src/pmc/default.c:1971: warning: unused parameter 'method_name' ./src/pmc/default.c: In function 'Parrot_default_remove_parent': ./src/pmc/default.c:1977: warning: unused parameter 'parent' ./src/pmc/default.c: In function 'Parrot_default_remove_role': ./src/pmc/default.c:1983: warning: unused parameter 'role' ./src/pmc/default.c: In function 'Parrot_default_remove_vtable_override': ./src/pmc/default.c:1989: warning: unused parameter 'vtable_name' ./src/pmc/default.c: In function 'Parrot_default_set_attr_keyed': ./src/pmc/default.c:2017: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_set_attr_str': ./src/pmc/default.c:2025: warning: unused parameter 'idx' ./src/pmc/default.c:2025: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_bignum_int': ./src/pmc/default.c:2031: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_bignum_num': ./src/pmc/default.c:2037: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_bignum_str': ./src/pmc/default.c:2043: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_bool': ./src/pmc/default.c:2049: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_integer_keyed': ./src/pmc/default.c:2055: warning: unused parameter 'key' ./src/pmc/default.c:2055: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_integer_keyed_str': ./src/pmc/default.c:2070: warning: unused parameter 'key' ./src/pmc/default.c:2070: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_integer_native': ./src/pmc/default.c:2076: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_integer_same': ./src/pmc/default.c:2082: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_number_keyed': ./src/pmc/default.c:2088: warning: unused parameter 'key' ./src/pmc/default.c:2088: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_number_keyed_str': ./src/pmc/default.c:2103: warning: unused parameter 'key' ./src/pmc/default.c:2103: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_number_native': ./src/pmc/default.c:2109: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_number_same': ./src/pmc/default.c:2115: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_pmc': ./src/pmc/default.c:2121: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_pmc_keyed': ./src/pmc/default.c:2127: warning: unused parameter 'key' ./src/pmc/default.c:2127: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_pmc_keyed_str': ./src/pmc/default.c:2142: warning: unused parameter 'key' ./src/pmc/default.c:2142: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_pointer': ./src/pmc/default.c:2148: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_pointer_keyed': ./src/pmc/default.c:2154: warning: unused parameter 'key' ./src/pmc/default.c:2154: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_pointer_keyed_int': ./src/pmc/default.c:2160: warning: unused parameter 'key' ./src/pmc/default.c:2160: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_pointer_keyed_str': ./src/pmc/default.c:2166: warning: unused parameter 'key' ./src/pmc/default.c:2166: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_string_keyed': ./src/pmc/default.c:2172: warning: unused parameter 'key' ./src/pmc/default.c:2172: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_string_keyed_str': ./src/pmc/default.c:2187: warning: unused parameter 'key' ./src/pmc/default.c:2187: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_string_native': ./src/pmc/default.c:2193: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_set_string_same': ./src/pmc/default.c:2199: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_slice': ./src/pmc/default.c:2260: warning: unused parameter 'key' ./src/pmc/default.c:2260: warning: unused parameter 'flag' ./src/pmc/default.c: In function 'Parrot_default_splice': ./src/pmc/default.c:2266: warning: unused parameter 'value' ./src/pmc/default.c:2266: warning: unused parameter 'offset' ./src/pmc/default.c:2266: warning: unused parameter 'count' ./src/pmc/default.c: In function 'Parrot_default_substr': ./src/pmc/default.c:2272: warning: unused parameter 'offset' ./src/pmc/default.c:2272: warning: unused parameter 'length' ./src/pmc/default.c:2272: warning: unused parameter 'dest' ./src/pmc/default.c: In function 'Parrot_default_substr_str': ./src/pmc/default.c:2278: warning: unused parameter 'offset' ./src/pmc/default.c:2278: warning: unused parameter 'length' ./src/pmc/default.c: In function 'Parrot_default_thawfinish': ./src/pmc/default.c:2336: warning: unused parameter 'interp' ./src/pmc/default.c:2336: warning: unused parameter 'pmc' ./src/pmc/default.c:2336: warning: unused parameter 'info' ./src/pmc/default.c: In function 'Parrot_default_type': ./src/pmc/default.c:2344: warning: unused parameter 'interp' ./src/pmc/default.c: In function 'Parrot_default_type_keyed': ./src/pmc/default.c:2352: warning: unused parameter 'key' ./src/pmc/default.c: In function 'Parrot_default_unshift_float': ./src/pmc/default.c:2358: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_unshift_integer': ./src/pmc/default.c:2364: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_unshift_pmc': ./src/pmc/default.c:2370: warning: unused parameter 'value' ./src/pmc/default.c: In function 'Parrot_default_unshift_string': ./src/pmc/default.c:2376: warning: unused parameter 'value' src/pmc/null.c ./src/pmc/null.c: In function 'Parrot_Null_absolute': ./src/pmc/null.c:45: warning: unused parameter 'pmc' ./src/pmc/null.c:45: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_add': ./src/pmc/null.c:51: warning: unused parameter 'pmc' ./src/pmc/null.c:51: warning: unused parameter 'value' ./src/pmc/null.c:51: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_add_attribute': ./src/pmc/null.c:57: warning: unused parameter 'pmc' ./src/pmc/null.c:57: warning: unused parameter 'name' ./src/pmc/null.c:57: warning: unused parameter 'type' ./src/pmc/null.c: In function 'Parrot_Null_add_float': ./src/pmc/null.c:63: warning: unused parameter 'pmc' ./src/pmc/null.c:63: warning: unused parameter 'value' ./src/pmc/null.c:63: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_add_int': ./src/pmc/null.c:69: warning: unused parameter 'pmc' ./src/pmc/null.c:69: warning: unused parameter 'value' ./src/pmc/null.c:69: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_add_method': ./src/pmc/null.c:75: warning: unused parameter 'pmc' ./src/pmc/null.c:75: warning: unused parameter 'method_name' ./src/pmc/null.c:75: warning: unused parameter 'sub_pmc' ./src/pmc/null.c: In function 'Parrot_Null_add_parent': ./src/pmc/null.c:81: warning: unused parameter 'pmc' ./src/pmc/null.c:81: warning: unused parameter 'parent' ./src/pmc/null.c: In function 'Parrot_Null_add_role': ./src/pmc/null.c:87: warning: unused parameter 'pmc' ./src/pmc/null.c:87: warning: unused parameter 'role' ./src/pmc/null.c: In function 'Parrot_Null_add_vtable_override': ./src/pmc/null.c:93: warning: unused parameter 'pmc' ./src/pmc/null.c:93: warning: unused parameter 'vtable_name' ./src/pmc/null.c:93: warning: unused parameter 'sub_pmc' ./src/pmc/null.c: In function 'Parrot_Null_assign_pmc': ./src/pmc/null.c:99: warning: unused parameter 'pmc' ./src/pmc/null.c:99: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_assign_string_native': ./src/pmc/null.c:105: warning: unused parameter 'pmc' ./src/pmc/null.c:105: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_and': ./src/pmc/null.c:111: warning: unused parameter 'pmc' ./src/pmc/null.c:111: warning: unused parameter 'value' ./src/pmc/null.c:111: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_and_int': ./src/pmc/null.c:117: warning: unused parameter 'pmc' ./src/pmc/null.c:117: warning: unused parameter 'value' ./src/pmc/null.c:117: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_ands': ./src/pmc/null.c:123: warning: unused parameter 'pmc' ./src/pmc/null.c:123: warning: unused parameter 'value' ./src/pmc/null.c:123: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_ands_str': ./src/pmc/null.c:129: warning: unused parameter 'pmc' ./src/pmc/null.c:129: warning: unused parameter 'value' ./src/pmc/null.c:129: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_lsr': ./src/pmc/null.c:135: warning: unused parameter 'pmc' ./src/pmc/null.c:135: warning: unused parameter 'value' ./src/pmc/null.c:135: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_lsr_int': ./src/pmc/null.c:141: warning: unused parameter 'pmc' ./src/pmc/null.c:141: warning: unused parameter 'value' ./src/pmc/null.c:141: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_not': ./src/pmc/null.c:147: warning: unused parameter 'pmc' ./src/pmc/null.c:147: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_nots': ./src/pmc/null.c:153: warning: unused parameter 'pmc' ./src/pmc/null.c:153: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_or': ./src/pmc/null.c:159: warning: unused parameter 'pmc' ./src/pmc/null.c:159: warning: unused parameter 'value' ./src/pmc/null.c:159: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_or_int': ./src/pmc/null.c:165: warning: unused parameter 'pmc' ./src/pmc/null.c:165: warning: unused parameter 'value' ./src/pmc/null.c:165: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_ors': ./src/pmc/null.c:171: warning: unused parameter 'pmc' ./src/pmc/null.c:171: warning: unused parameter 'value' ./src/pmc/null.c:171: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_ors_str': ./src/pmc/null.c:177: warning: unused parameter 'pmc' ./src/pmc/null.c:177: warning: unused parameter 'value' ./src/pmc/null.c:177: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_shl': ./src/pmc/null.c:183: warning: unused parameter 'pmc' ./src/pmc/null.c:183: warning: unused parameter 'value' ./src/pmc/null.c:183: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_shl_int': ./src/pmc/null.c:189: warning: unused parameter 'pmc' ./src/pmc/null.c:189: warning: unused parameter 'value' ./src/pmc/null.c:189: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_shr': ./src/pmc/null.c:195: warning: unused parameter 'pmc' ./src/pmc/null.c:195: warning: unused parameter 'value' ./src/pmc/null.c:195: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_shr_int': ./src/pmc/null.c:201: warning: unused parameter 'pmc' ./src/pmc/null.c:201: warning: unused parameter 'value' ./src/pmc/null.c:201: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_xor': ./src/pmc/null.c:207: warning: unused parameter 'pmc' ./src/pmc/null.c:207: warning: unused parameter 'value' ./src/pmc/null.c:207: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_xor_int': ./src/pmc/null.c:213: warning: unused parameter 'pmc' ./src/pmc/null.c:213: warning: unused parameter 'value' ./src/pmc/null.c:213: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_xors': ./src/pmc/null.c:219: warning: unused parameter 'pmc' ./src/pmc/null.c:219: warning: unused parameter 'value' ./src/pmc/null.c:219: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_bitwise_xors_str': ./src/pmc/null.c:225: warning: unused parameter 'pmc' ./src/pmc/null.c:225: warning: unused parameter 'value' ./src/pmc/null.c:225: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_can': ./src/pmc/null.c:231: warning: unused parameter 'pmc' ./src/pmc/null.c:231: warning: unused parameter 'method' ./src/pmc/null.c: In function 'Parrot_Null_clone': ./src/pmc/null.c:237: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_clone_pmc': ./src/pmc/null.c:243: warning: unused parameter 'pmc' ./src/pmc/null.c:243: warning: unused parameter 'args' ./src/pmc/null.c: In function 'Parrot_Null_cmp': ./src/pmc/null.c:249: warning: unused parameter 'pmc' ./src/pmc/null.c:249: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_cmp_num': ./src/pmc/null.c:255: warning: unused parameter 'pmc' ./src/pmc/null.c:255: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_cmp_pmc': ./src/pmc/null.c:261: warning: unused parameter 'pmc' ./src/pmc/null.c:261: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_cmp_string': ./src/pmc/null.c:267: warning: unused parameter 'pmc' ./src/pmc/null.c:267: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_concatenate': ./src/pmc/null.c:273: warning: unused parameter 'pmc' ./src/pmc/null.c:273: warning: unused parameter 'value' ./src/pmc/null.c:273: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_concatenate_str': ./src/pmc/null.c:279: warning: unused parameter 'pmc' ./src/pmc/null.c:279: warning: unused parameter 'value' ./src/pmc/null.c:279: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_decrement': ./src/pmc/null.c:285: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_defined': ./src/pmc/null.c:291: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_defined_keyed': ./src/pmc/null.c:297: warning: unused parameter 'pmc' ./src/pmc/null.c:297: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_defined_keyed_int': ./src/pmc/null.c:303: warning: unused parameter 'pmc' ./src/pmc/null.c:303: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_defined_keyed_str': ./src/pmc/null.c:309: warning: unused parameter 'pmc' ./src/pmc/null.c:309: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_delete_keyed': ./src/pmc/null.c:315: warning: unused parameter 'pmc' ./src/pmc/null.c:315: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_delete_keyed_int': ./src/pmc/null.c:321: warning: unused parameter 'pmc' ./src/pmc/null.c:321: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_delete_keyed_str': ./src/pmc/null.c:327: warning: unused parameter 'pmc' ./src/pmc/null.c:327: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_delprop': ./src/pmc/null.c:333: warning: unused parameter 'pmc' ./src/pmc/null.c:333: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_destroy': ./src/pmc/null.c:339: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_divide': ./src/pmc/null.c:345: warning: unused parameter 'pmc' ./src/pmc/null.c:345: warning: unused parameter 'value' ./src/pmc/null.c:345: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_divide_float': ./src/pmc/null.c:351: warning: unused parameter 'pmc' ./src/pmc/null.c:351: warning: unused parameter 'value' ./src/pmc/null.c:351: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_divide_int': ./src/pmc/null.c:357: warning: unused parameter 'pmc' ./src/pmc/null.c:357: warning: unused parameter 'value' ./src/pmc/null.c:357: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_does': ./src/pmc/null.c:363: warning: unused parameter 'interp' ./src/pmc/null.c:363: warning: unused parameter 'pmc' ./src/pmc/null.c:363: warning: unused parameter 'what' ./src/pmc/null.c: In function 'Parrot_Null_does_pmc': ./src/pmc/null.c:372: warning: unused parameter 'pmc' ./src/pmc/null.c:372: warning: unused parameter 'role' ./src/pmc/null.c: In function 'Parrot_Null_elements': ./src/pmc/null.c:378: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_exists_keyed': ./src/pmc/null.c:384: warning: unused parameter 'pmc' ./src/pmc/null.c:384: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_exists_keyed_int': ./src/pmc/null.c:390: warning: unused parameter 'pmc' ./src/pmc/null.c:390: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_exists_keyed_str': ./src/pmc/null.c:396: warning: unused parameter 'pmc' ./src/pmc/null.c:396: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_find_method': ./src/pmc/null.c:402: warning: unused parameter 'pmc' ./src/pmc/null.c:402: warning: unused parameter 'method_name' ./src/pmc/null.c: In function 'Parrot_Null_floor_divide': ./src/pmc/null.c:408: warning: unused parameter 'pmc' ./src/pmc/null.c:408: warning: unused parameter 'value' ./src/pmc/null.c:408: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_floor_divide_float': ./src/pmc/null.c:414: warning: unused parameter 'pmc' ./src/pmc/null.c:414: warning: unused parameter 'value' ./src/pmc/null.c:414: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_floor_divide_int': ./src/pmc/null.c:420: warning: unused parameter 'pmc' ./src/pmc/null.c:420: warning: unused parameter 'value' ./src/pmc/null.c:420: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_freeze': ./src/pmc/null.c:426: warning: unused parameter 'pmc' ./src/pmc/null.c:426: warning: unused parameter 'info' ./src/pmc/null.c: In function 'Parrot_Null_get_attr_keyed': ./src/pmc/null.c:432: warning: unused parameter 'pmc' ./src/pmc/null.c:432: warning: unused parameter 'key' ./src/pmc/null.c:432: warning: unused parameter 'idx' ./src/pmc/null.c: In function 'Parrot_Null_get_attr_str': ./src/pmc/null.c:438: warning: unused parameter 'pmc' ./src/pmc/null.c:438: warning: unused parameter 'idx' ./src/pmc/null.c: In function 'Parrot_Null_get_bignum': ./src/pmc/null.c:444: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_bool': ./src/pmc/null.c:450: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_class': ./src/pmc/null.c:456: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_integer': ./src/pmc/null.c:462: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_integer_keyed': ./src/pmc/null.c:468: warning: unused parameter 'pmc' ./src/pmc/null.c:468: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_integer_keyed_int': ./src/pmc/null.c:474: warning: unused parameter 'pmc' ./src/pmc/null.c:474: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_integer_keyed_str': ./src/pmc/null.c:480: warning: unused parameter 'pmc' ./src/pmc/null.c:480: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_iter': ./src/pmc/null.c:486: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_namespace': ./src/pmc/null.c:492: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_number': ./src/pmc/null.c:498: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_number_keyed': ./src/pmc/null.c:504: warning: unused parameter 'pmc' ./src/pmc/null.c:504: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_number_keyed_int': ./src/pmc/null.c:510: warning: unused parameter 'pmc' ./src/pmc/null.c:510: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_number_keyed_str': ./src/pmc/null.c:516: warning: unused parameter 'pmc' ./src/pmc/null.c:516: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_pmc': ./src/pmc/null.c:522: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_pmc_keyed': ./src/pmc/null.c:528: warning: unused parameter 'pmc' ./src/pmc/null.c:528: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_pmc_keyed_int': ./src/pmc/null.c:534: warning: unused parameter 'pmc' ./src/pmc/null.c:534: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_pmc_keyed_str': ./src/pmc/null.c:540: warning: unused parameter 'pmc' ./src/pmc/null.c:540: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_pointer': ./src/pmc/null.c:547: warning: unused parameter 'interp' ./src/pmc/null.c:547: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_pointer_keyed': ./src/pmc/null.c:555: warning: unused parameter 'pmc' ./src/pmc/null.c:555: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_pointer_keyed_int': ./src/pmc/null.c:561: warning: unused parameter 'pmc' ./src/pmc/null.c:561: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_pointer_keyed_str': ./src/pmc/null.c:567: warning: unused parameter 'pmc' ./src/pmc/null.c:567: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_repr': ./src/pmc/null.c:573: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_string': ./src/pmc/null.c:579: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_get_string_keyed': ./src/pmc/null.c:585: warning: unused parameter 'pmc' ./src/pmc/null.c:585: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_string_keyed_int': ./src/pmc/null.c:591: warning: unused parameter 'pmc' ./src/pmc/null.c:591: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_get_string_keyed_str': ./src/pmc/null.c:597: warning: unused parameter 'pmc' ./src/pmc/null.c:597: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_getprop': ./src/pmc/null.c:603: warning: unused parameter 'pmc' ./src/pmc/null.c:603: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_getprops': ./src/pmc/null.c:609: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_i_absolute': ./src/pmc/null.c:615: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_i_add': ./src/pmc/null.c:621: warning: unused parameter 'pmc' ./src/pmc/null.c:621: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_add_float': ./src/pmc/null.c:627: warning: unused parameter 'pmc' ./src/pmc/null.c:627: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_add_int': ./src/pmc/null.c:633: warning: unused parameter 'pmc' ./src/pmc/null.c:633: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_and': ./src/pmc/null.c:639: warning: unused parameter 'pmc' ./src/pmc/null.c:639: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_and_int': ./src/pmc/null.c:645: warning: unused parameter 'pmc' ./src/pmc/null.c:645: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_ands': ./src/pmc/null.c:651: warning: unused parameter 'pmc' ./src/pmc/null.c:651: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_ands_str': ./src/pmc/null.c:657: warning: unused parameter 'pmc' ./src/pmc/null.c:657: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_lsr': ./src/pmc/null.c:663: warning: unused parameter 'pmc' ./src/pmc/null.c:663: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_lsr_int': ./src/pmc/null.c:669: warning: unused parameter 'pmc' ./src/pmc/null.c:669: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_not': ./src/pmc/null.c:675: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_nots': ./src/pmc/null.c:681: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_or': ./src/pmc/null.c:687: warning: unused parameter 'pmc' ./src/pmc/null.c:687: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_or_int': ./src/pmc/null.c:693: warning: unused parameter 'pmc' ./src/pmc/null.c:693: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_ors': ./src/pmc/null.c:699: warning: unused parameter 'pmc' ./src/pmc/null.c:699: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_ors_str': ./src/pmc/null.c:705: warning: unused parameter 'pmc' ./src/pmc/null.c:705: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_shl': ./src/pmc/null.c:711: warning: unused parameter 'pmc' ./src/pmc/null.c:711: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_shl_int': ./src/pmc/null.c:717: warning: unused parameter 'pmc' ./src/pmc/null.c:717: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_shr': ./src/pmc/null.c:723: warning: unused parameter 'pmc' ./src/pmc/null.c:723: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_shr_int': ./src/pmc/null.c:729: warning: unused parameter 'pmc' ./src/pmc/null.c:729: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_xor': ./src/pmc/null.c:735: warning: unused parameter 'pmc' ./src/pmc/null.c:735: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_xor_int': ./src/pmc/null.c:741: warning: unused parameter 'pmc' ./src/pmc/null.c:741: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_xors': ./src/pmc/null.c:747: warning: unused parameter 'pmc' ./src/pmc/null.c:747: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_bitwise_xors_str': ./src/pmc/null.c:753: warning: unused parameter 'pmc' ./src/pmc/null.c:753: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_concatenate': ./src/pmc/null.c:759: warning: unused parameter 'pmc' ./src/pmc/null.c:759: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_concatenate_str': ./src/pmc/null.c:765: warning: unused parameter 'pmc' ./src/pmc/null.c:765: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_divide': ./src/pmc/null.c:771: warning: unused parameter 'pmc' ./src/pmc/null.c:771: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_divide_float': ./src/pmc/null.c:777: warning: unused parameter 'pmc' ./src/pmc/null.c:777: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_divide_int': ./src/pmc/null.c:783: warning: unused parameter 'pmc' ./src/pmc/null.c:783: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_floor_divide': ./src/pmc/null.c:789: warning: unused parameter 'pmc' ./src/pmc/null.c:789: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_floor_divide_float': ./src/pmc/null.c:795: warning: unused parameter 'pmc' ./src/pmc/null.c:795: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_floor_divide_int': ./src/pmc/null.c:801: warning: unused parameter 'pmc' ./src/pmc/null.c:801: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_logical_not': ./src/pmc/null.c:807: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_i_modulus': ./src/pmc/null.c:813: warning: unused parameter 'pmc' ./src/pmc/null.c:813: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_modulus_float': ./src/pmc/null.c:819: warning: unused parameter 'pmc' ./src/pmc/null.c:819: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_modulus_int': ./src/pmc/null.c:825: warning: unused parameter 'pmc' ./src/pmc/null.c:825: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_multiply': ./src/pmc/null.c:831: warning: unused parameter 'pmc' ./src/pmc/null.c:831: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_multiply_float': ./src/pmc/null.c:837: warning: unused parameter 'pmc' ./src/pmc/null.c:837: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_multiply_int': ./src/pmc/null.c:843: warning: unused parameter 'pmc' ./src/pmc/null.c:843: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_neg': ./src/pmc/null.c:849: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_i_pow': ./src/pmc/null.c:855: warning: unused parameter 'pmc' ./src/pmc/null.c:855: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_pow_float': ./src/pmc/null.c:861: warning: unused parameter 'pmc' ./src/pmc/null.c:861: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_pow_int': ./src/pmc/null.c:867: warning: unused parameter 'pmc' ./src/pmc/null.c:867: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_repeat': ./src/pmc/null.c:873: warning: unused parameter 'pmc' ./src/pmc/null.c:873: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_repeat_int': ./src/pmc/null.c:879: warning: unused parameter 'pmc' ./src/pmc/null.c:879: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_subtract': ./src/pmc/null.c:885: warning: unused parameter 'pmc' ./src/pmc/null.c:885: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_subtract_float': ./src/pmc/null.c:891: warning: unused parameter 'pmc' ./src/pmc/null.c:891: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_i_subtract_int': ./src/pmc/null.c:897: warning: unused parameter 'pmc' ./src/pmc/null.c:897: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_increment': ./src/pmc/null.c:903: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_init': ./src/pmc/null.c:909: warning: unused parameter 'interp' ./src/pmc/null.c:909: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_init_pmc': ./src/pmc/null.c:916: warning: unused parameter 'pmc' ./src/pmc/null.c:916: warning: unused parameter 'initializer' ./src/pmc/null.c: In function 'Parrot_Null_inspect': ./src/pmc/null.c:922: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_inspect_str': ./src/pmc/null.c:928: warning: unused parameter 'pmc' ./src/pmc/null.c:928: warning: unused parameter 'what' ./src/pmc/null.c: In function 'Parrot_Null_instantiate': ./src/pmc/null.c:934: warning: unused parameter 'pmc' ./src/pmc/null.c:934: warning: unused parameter 'sig' ./src/pmc/null.c: In function 'Parrot_Null_instantiate_str': ./src/pmc/null.c:940: warning: unused parameter 'pmc' ./src/pmc/null.c:940: warning: unused parameter 'rep' ./src/pmc/null.c:940: warning: unused parameter 'flags' ./src/pmc/null.c: In function 'Parrot_Null_invoke': ./src/pmc/null.c:946: warning: unused parameter 'pmc' ./src/pmc/null.c:946: warning: unused parameter 'next' ./src/pmc/null.c: In function 'Parrot_Null_is_equal': ./src/pmc/null.c:952: warning: unused parameter 'pmc' ./src/pmc/null.c:952: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_is_equal_num': ./src/pmc/null.c:958: warning: unused parameter 'pmc' ./src/pmc/null.c:958: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_is_equal_string': ./src/pmc/null.c:964: warning: unused parameter 'pmc' ./src/pmc/null.c:964: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_is_same': ./src/pmc/null.c:970: warning: unused parameter 'interp' ./src/pmc/null.c:970: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_isa': ./src/pmc/null.c:978: warning: unused parameter 'pmc' ./src/pmc/null.c:978: warning: unused parameter '_class' ./src/pmc/null.c: In function 'Parrot_Null_isa_pmc': ./src/pmc/null.c:984: warning: unused parameter 'pmc' ./src/pmc/null.c:984: warning: unused parameter '_class' ./src/pmc/null.c: In function 'Parrot_Null_logical_and': ./src/pmc/null.c:990: warning: unused parameter 'pmc' ./src/pmc/null.c:990: warning: unused parameter 'value' ./src/pmc/null.c:990: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_logical_not': ./src/pmc/null.c:996: warning: unused parameter 'pmc' ./src/pmc/null.c:996: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_logical_or': ./src/pmc/null.c:1002: warning: unused parameter 'pmc' ./src/pmc/null.c:1002: warning: unused parameter 'value' ./src/pmc/null.c:1002: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_logical_xor': ./src/pmc/null.c:1008: warning: unused parameter 'pmc' ./src/pmc/null.c:1008: warning: unused parameter 'value' ./src/pmc/null.c:1008: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_mark': ./src/pmc/null.c:1014: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_modulus': ./src/pmc/null.c:1020: warning: unused parameter 'pmc' ./src/pmc/null.c:1020: warning: unused parameter 'value' ./src/pmc/null.c:1020: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_modulus_float': ./src/pmc/null.c:1026: warning: unused parameter 'pmc' ./src/pmc/null.c:1026: warning: unused parameter 'value' ./src/pmc/null.c:1026: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_modulus_int': ./src/pmc/null.c:1032: warning: unused parameter 'pmc' ./src/pmc/null.c:1032: warning: unused parameter 'value' ./src/pmc/null.c:1032: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_morph': ./src/pmc/null.c:1038: warning: unused parameter 'pmc' ./src/pmc/null.c:1038: warning: unused parameter 'type' ./src/pmc/null.c: In function 'Parrot_Null_multiply': ./src/pmc/null.c:1044: warning: unused parameter 'pmc' ./src/pmc/null.c:1044: warning: unused parameter 'value' ./src/pmc/null.c:1044: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_multiply_float': ./src/pmc/null.c:1050: warning: unused parameter 'pmc' ./src/pmc/null.c:1050: warning: unused parameter 'value' ./src/pmc/null.c:1050: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_multiply_int': ./src/pmc/null.c:1056: warning: unused parameter 'pmc' ./src/pmc/null.c:1056: warning: unused parameter 'value' ./src/pmc/null.c:1056: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_name': ./src/pmc/null.c:1062: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_neg': ./src/pmc/null.c:1068: warning: unused parameter 'pmc' ./src/pmc/null.c:1068: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_nextkey_keyed': ./src/pmc/null.c:1074: warning: unused parameter 'pmc' ./src/pmc/null.c:1074: warning: unused parameter 'key' ./src/pmc/null.c:1074: warning: unused parameter 'what' ./src/pmc/null.c: In function 'Parrot_Null_nextkey_keyed_int': ./src/pmc/null.c:1080: warning: unused parameter 'pmc' ./src/pmc/null.c:1080: warning: unused parameter 'key' ./src/pmc/null.c:1080: warning: unused parameter 'what' ./src/pmc/null.c: In function 'Parrot_Null_nextkey_keyed_str': ./src/pmc/null.c:1086: warning: unused parameter 'pmc' ./src/pmc/null.c:1086: warning: unused parameter 'key' ./src/pmc/null.c:1086: warning: unused parameter 'what' ./src/pmc/null.c: In function 'Parrot_Null_pop_float': ./src/pmc/null.c:1092: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_pop_integer': ./src/pmc/null.c:1098: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_pop_pmc': ./src/pmc/null.c:1104: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_pop_string': ./src/pmc/null.c:1110: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_pow': ./src/pmc/null.c:1116: warning: unused parameter 'pmc' ./src/pmc/null.c:1116: warning: unused parameter 'value' ./src/pmc/null.c:1116: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_pow_float': ./src/pmc/null.c:1122: warning: unused parameter 'pmc' ./src/pmc/null.c:1122: warning: unused parameter 'value' ./src/pmc/null.c:1122: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_pow_int': ./src/pmc/null.c:1128: warning: unused parameter 'pmc' ./src/pmc/null.c:1128: warning: unused parameter 'value' ./src/pmc/null.c:1128: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_push_float': ./src/pmc/null.c:1134: warning: unused parameter 'pmc' ./src/pmc/null.c:1134: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_push_integer': ./src/pmc/null.c:1140: warning: unused parameter 'pmc' ./src/pmc/null.c:1140: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_push_pmc': ./src/pmc/null.c:1146: warning: unused parameter 'pmc' ./src/pmc/null.c:1146: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_push_string': ./src/pmc/null.c:1152: warning: unused parameter 'pmc' ./src/pmc/null.c:1152: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_remove_attribute': ./src/pmc/null.c:1158: warning: unused parameter 'pmc' ./src/pmc/null.c:1158: warning: unused parameter 'name' ./src/pmc/null.c: In function 'Parrot_Null_remove_method': ./src/pmc/null.c:1164: warning: unused parameter 'pmc' ./src/pmc/null.c:1164: warning: unused parameter 'method_name' ./src/pmc/null.c: In function 'Parrot_Null_remove_parent': ./src/pmc/null.c:1170: warning: unused parameter 'pmc' ./src/pmc/null.c:1170: warning: unused parameter 'parent' ./src/pmc/null.c: In function 'Parrot_Null_remove_role': ./src/pmc/null.c:1176: warning: unused parameter 'pmc' ./src/pmc/null.c:1176: warning: unused parameter 'role' ./src/pmc/null.c: In function 'Parrot_Null_remove_vtable_override': ./src/pmc/null.c:1182: warning: unused parameter 'pmc' ./src/pmc/null.c:1182: warning: unused parameter 'vtable_name' ./src/pmc/null.c: In function 'Parrot_Null_repeat': ./src/pmc/null.c:1188: warning: unused parameter 'pmc' ./src/pmc/null.c:1188: warning: unused parameter 'value' ./src/pmc/null.c:1188: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_repeat_int': ./src/pmc/null.c:1194: warning: unused parameter 'pmc' ./src/pmc/null.c:1194: warning: unused parameter 'value' ./src/pmc/null.c:1194: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_set_attr_keyed': ./src/pmc/null.c:1200: warning: unused parameter 'pmc' ./src/pmc/null.c:1200: warning: unused parameter 'key' ./src/pmc/null.c:1200: warning: unused parameter 'idx' ./src/pmc/null.c:1200: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_attr_str': ./src/pmc/null.c:1206: warning: unused parameter 'pmc' ./src/pmc/null.c:1206: warning: unused parameter 'idx' ./src/pmc/null.c:1206: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_bignum_int': ./src/pmc/null.c:1212: warning: unused parameter 'pmc' ./src/pmc/null.c:1212: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_bignum_num': ./src/pmc/null.c:1218: warning: unused parameter 'pmc' ./src/pmc/null.c:1218: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_bignum_str': ./src/pmc/null.c:1224: warning: unused parameter 'pmc' ./src/pmc/null.c:1224: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_bool': ./src/pmc/null.c:1230: warning: unused parameter 'pmc' ./src/pmc/null.c:1230: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_integer_keyed': ./src/pmc/null.c:1236: warning: unused parameter 'pmc' ./src/pmc/null.c:1236: warning: unused parameter 'key' ./src/pmc/null.c:1236: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_integer_keyed_int': ./src/pmc/null.c:1242: warning: unused parameter 'pmc' ./src/pmc/null.c:1242: warning: unused parameter 'key' ./src/pmc/null.c:1242: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_integer_keyed_str': ./src/pmc/null.c:1248: warning: unused parameter 'pmc' ./src/pmc/null.c:1248: warning: unused parameter 'key' ./src/pmc/null.c:1248: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_integer_native': ./src/pmc/null.c:1254: warning: unused parameter 'pmc' ./src/pmc/null.c:1254: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_integer_same': ./src/pmc/null.c:1260: warning: unused parameter 'pmc' ./src/pmc/null.c:1260: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_number_keyed': ./src/pmc/null.c:1266: warning: unused parameter 'pmc' ./src/pmc/null.c:1266: warning: unused parameter 'key' ./src/pmc/null.c:1266: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_number_keyed_int': ./src/pmc/null.c:1272: warning: unused parameter 'pmc' ./src/pmc/null.c:1272: warning: unused parameter 'key' ./src/pmc/null.c:1272: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_number_keyed_str': ./src/pmc/null.c:1278: warning: unused parameter 'pmc' ./src/pmc/null.c:1278: warning: unused parameter 'key' ./src/pmc/null.c:1278: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_number_native': ./src/pmc/null.c:1284: warning: unused parameter 'pmc' ./src/pmc/null.c:1284: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_number_same': ./src/pmc/null.c:1290: warning: unused parameter 'pmc' ./src/pmc/null.c:1290: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_pmc': ./src/pmc/null.c:1296: warning: unused parameter 'pmc' ./src/pmc/null.c:1296: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_pmc_keyed': ./src/pmc/null.c:1302: warning: unused parameter 'pmc' ./src/pmc/null.c:1302: warning: unused parameter 'key' ./src/pmc/null.c:1302: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_pmc_keyed_int': ./src/pmc/null.c:1308: warning: unused parameter 'pmc' ./src/pmc/null.c:1308: warning: unused parameter 'key' ./src/pmc/null.c:1308: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_pmc_keyed_str': ./src/pmc/null.c:1314: warning: unused parameter 'pmc' ./src/pmc/null.c:1314: warning: unused parameter 'key' ./src/pmc/null.c:1314: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_pointer': ./src/pmc/null.c:1320: warning: unused parameter 'interp' ./src/pmc/null.c:1320: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_set_pointer_keyed': ./src/pmc/null.c:1328: warning: unused parameter 'pmc' ./src/pmc/null.c:1328: warning: unused parameter 'key' ./src/pmc/null.c:1328: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_pointer_keyed_int': ./src/pmc/null.c:1334: warning: unused parameter 'pmc' ./src/pmc/null.c:1334: warning: unused parameter 'key' ./src/pmc/null.c:1334: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_pointer_keyed_str': ./src/pmc/null.c:1340: warning: unused parameter 'pmc' ./src/pmc/null.c:1340: warning: unused parameter 'key' ./src/pmc/null.c:1340: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_string_keyed': ./src/pmc/null.c:1346: warning: unused parameter 'pmc' ./src/pmc/null.c:1346: warning: unused parameter 'key' ./src/pmc/null.c:1346: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_string_keyed_int': ./src/pmc/null.c:1352: warning: unused parameter 'pmc' ./src/pmc/null.c:1352: warning: unused parameter 'key' ./src/pmc/null.c:1352: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_string_keyed_str': ./src/pmc/null.c:1358: warning: unused parameter 'pmc' ./src/pmc/null.c:1358: warning: unused parameter 'key' ./src/pmc/null.c:1358: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_string_native': ./src/pmc/null.c:1364: warning: unused parameter 'pmc' ./src/pmc/null.c:1364: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_set_string_same': ./src/pmc/null.c:1370: warning: unused parameter 'pmc' ./src/pmc/null.c:1370: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_setprop': ./src/pmc/null.c:1376: warning: unused parameter 'pmc' ./src/pmc/null.c:1376: warning: unused parameter 'key' ./src/pmc/null.c:1376: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_share': ./src/pmc/null.c:1382: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_share_ro': ./src/pmc/null.c:1388: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_shift_float': ./src/pmc/null.c:1394: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_shift_integer': ./src/pmc/null.c:1400: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_shift_pmc': ./src/pmc/null.c:1406: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_shift_string': ./src/pmc/null.c:1412: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_slice': ./src/pmc/null.c:1418: warning: unused parameter 'pmc' ./src/pmc/null.c:1418: warning: unused parameter 'key' ./src/pmc/null.c:1418: warning: unused parameter 'flag' ./src/pmc/null.c: In function 'Parrot_Null_splice': ./src/pmc/null.c:1424: warning: unused parameter 'pmc' ./src/pmc/null.c:1424: warning: unused parameter 'value' ./src/pmc/null.c:1424: warning: unused parameter 'offset' ./src/pmc/null.c:1424: warning: unused parameter 'count' ./src/pmc/null.c: In function 'Parrot_Null_substr': ./src/pmc/null.c:1430: warning: unused parameter 'pmc' ./src/pmc/null.c:1430: warning: unused parameter 'offset' ./src/pmc/null.c:1430: warning: unused parameter 'length' ./src/pmc/null.c:1430: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_substr_str': ./src/pmc/null.c:1436: warning: unused parameter 'pmc' ./src/pmc/null.c:1436: warning: unused parameter 'offset' ./src/pmc/null.c:1436: warning: unused parameter 'length' ./src/pmc/null.c: In function 'Parrot_Null_subtract': ./src/pmc/null.c:1442: warning: unused parameter 'pmc' ./src/pmc/null.c:1442: warning: unused parameter 'value' ./src/pmc/null.c:1442: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_subtract_float': ./src/pmc/null.c:1448: warning: unused parameter 'pmc' ./src/pmc/null.c:1448: warning: unused parameter 'value' ./src/pmc/null.c:1448: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_subtract_int': ./src/pmc/null.c:1454: warning: unused parameter 'pmc' ./src/pmc/null.c:1454: warning: unused parameter 'value' ./src/pmc/null.c:1454: warning: unused parameter 'dest' ./src/pmc/null.c: In function 'Parrot_Null_thaw': ./src/pmc/null.c:1460: warning: unused parameter 'pmc' ./src/pmc/null.c:1460: warning: unused parameter 'info' ./src/pmc/null.c: In function 'Parrot_Null_thawfinish': ./src/pmc/null.c:1466: warning: unused parameter 'pmc' ./src/pmc/null.c:1466: warning: unused parameter 'info' ./src/pmc/null.c: In function 'Parrot_Null_type': ./src/pmc/null.c:1472: warning: unused parameter 'pmc' ./src/pmc/null.c: In function 'Parrot_Null_type_keyed': ./src/pmc/null.c:1478: warning: unused parameter 'pmc' ./src/pmc/null.c:1478: warning: unused parameter 'key' ./src/pmc/null.c: In function 'Parrot_Null_unshift_float': ./src/pmc/null.c:1484: warning: unused parameter 'pmc' ./src/pmc/null.c:1484: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_unshift_integer': ./src/pmc/null.c:1490: warning: unused parameter 'pmc' ./src/pmc/null.c:1490: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_unshift_pmc': ./src/pmc/null.c:1496: warning: unused parameter 'pmc' ./src/pmc/null.c:1496: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_unshift_string': ./src/pmc/null.c:1502: warning: unused parameter 'pmc' ./src/pmc/null.c:1502: warning: unused parameter 'value' ./src/pmc/null.c: In function 'Parrot_Null_visit': ./src/pmc/null.c:1508: warning: unused parameter 'pmc' ./src/pmc/null.c:1508: warning: unused parameter 'info' src/pmc/env.c ./src/pmc/env.c: In function 'Parrot_Env_delete_keyed': ./src/pmc/env.c:61: warning: unused parameter 'pmc' ./src/pmc/env.c: In function 'Parrot_Env_elements': ./src/pmc/env.c:84: warning: unused parameter 'interp' ./src/pmc/env.c:84: warning: unused parameter 'pmc' ./src/pmc/env.c: In function 'Parrot_Env_exists_keyed': ./src/pmc/env.c:97: warning: unused parameter 'pmc' ./src/pmc/env.c: In function 'Parrot_Env_get_pmc_keyed': ./src/pmc/env.c:161: warning: unused parameter 'pmc' ./src/pmc/env.c: In function 'Parrot_Env_get_pointer': ./src/pmc/env.c:194: warning: unused parameter 'interp' ./src/pmc/env.c:194: warning: unused parameter 'pmc' ./src/pmc/env.c: In function 'Parrot_Env_set_pmc_keyed': ./src/pmc/env.c:242: warning: unused parameter 'pmc' ./src/pmc/env.c: In function 'Parrot_Env_set_pointer': ./src/pmc/env.c:263: warning: unused parameter 'interp' ./src/pmc/env.c:263: warning: unused parameter 'pmc' ./src/pmc/env.c: In function 'Parrot_Env_set_string_keyed': ./src/pmc/env.c:271: warning: unused parameter 'pmc' src/pmc/key.c ./src/pmc/key.c: In function 'Parrot_Key_destroy': ./src/pmc/key.c:93: warning: unused parameter 'interp' ./src/pmc/key.c: In function 'Parrot_Key_get_pmc_keyed': ./src/pmc/key.c:160: warning: unused parameter 'interp' ./src/pmc/key.c:160: warning: unused parameter 'pmc' ./src/pmc/key.c: In function 'Parrot_Key_init': ./src/pmc/key.c:188: warning: unused parameter 'interp' ./src/pmc/key.c: In function 'Parrot_Key_thawfinish': ./src/pmc/key.c:376: warning: unused parameter 'info' src/pmc/random.c ./src/pmc/random.c: In function 'Parrot_Random_get_integer': ./src/pmc/random.c:48: warning: unused parameter 'interp' ./src/pmc/random.c:48: warning: unused parameter 'pmc' ./src/pmc/random.c: In function 'Parrot_Random_get_integer_keyed_int': ./src/pmc/random.c:56: warning: unused parameter 'interp' ./src/pmc/random.c:56: warning: unused parameter 'pmc' ./src/pmc/random.c: In function 'Parrot_Random_get_number': ./src/pmc/random.c:69: warning: unused parameter 'interp' ./src/pmc/random.c:69: warning: unused parameter 'pmc' ./src/pmc/random.c: In function 'Parrot_Random_get_pointer': ./src/pmc/random.c:77: warning: unused parameter 'interp' ./src/pmc/random.c:77: warning: unused parameter 'pmc' ./src/pmc/random.c: In function 'Parrot_Random_set_integer_native': ./src/pmc/random.c:85: warning: unused parameter 'interp' ./src/pmc/random.c:85: warning: unused parameter 'pmc' ./src/pmc/random.c: In function 'Parrot_Random_set_pointer': ./src/pmc/random.c:93: warning: unused parameter 'interp' ./src/pmc/random.c:93: warning: unused parameter 'pmc' src/pmc/unmanagedstruct.c ./src/pmc/unmanagedstruct.pmc: In function 'calc_align': ./src/pmc/unmanagedstruct.pmc:537: warning: unused parameter 'pmc' ./src/pmc/unmanagedstruct.c: In function 'Parrot_UnManagedStruct_defined': ./src/pmc/unmanagedstruct.c:680: warning: unused parameter 'interp' ./src/pmc/unmanagedstruct.c: In function 'Parrot_UnManagedStruct_get_integer': ./src/pmc/unmanagedstruct.c:688: warning: unused parameter 'interp' ./src/pmc/unmanagedstruct.c: In function 'Parrot_UnManagedStruct_get_pointer': ./src/pmc/unmanagedstruct.c:756: warning: unused parameter 'interp' ./src/pmc/unmanagedstruct.c: In function 'Parrot_UnManagedStruct_init': ./src/pmc/unmanagedstruct.c:784: warning: unused parameter 'interp' ./src/pmc/unmanagedstruct.c: In function 'Parrot_UnManagedStruct_is_equal': ./src/pmc/unmanagedstruct.c:800: warning: unused parameter 'interp' ./src/pmc/unmanagedstruct.c: In function 'Parrot_UnManagedStruct_set_integer_native': ./src/pmc/unmanagedstruct.c:838: warning: unused parameter 'interp' ./src/pmc/unmanagedstruct.c: In function 'Parrot_UnManagedStruct_set_pointer': ./src/pmc/unmanagedstruct.c:876: warning: unused parameter 'interp' src/pmc/managedstruct.c ./src/pmc/managedstruct.c: In function 'Parrot_ManagedStruct_destroy': ./src/pmc/managedstruct.c:60: warning: unused parameter 'interp' ./src/pmc/managedstruct.c: In function 'Parrot_ManagedStruct_init': ./src/pmc/managedstruct.c:69: warning: unused parameter 'interp' ./src/pmc/managedstruct.c: In function 'Parrot_ManagedStruct_set_integer_native': ./src/pmc/managedstruct.c:88: warning: unused parameter 'interp' src/pmc/exception.c ./src/pmc/exception.c: In function 'Parrot_Exception_destroy': ./src/pmc/exception.c:78: warning: unused parameter 'interp' ./src/pmc/exception.c: In function 'Parrot_Exception_get_bool': ./src/pmc/exception.c:147: warning: unused parameter 'interp' ./src/pmc/exception.c:147: warning: unused parameter 'pmc' ./src/pmc/exception.c: In function 'Parrot_Exception_get_integer': ./src/pmc/exception.c:155: warning: unused parameter 'interp' ./src/pmc/exception.c: In function 'Parrot_Exception_get_pointer': ./src/pmc/exception.c:230: warning: unused parameter 'interp' ./src/pmc/exception.c: In function 'Parrot_Exception_nci_annotations': ./src/pmc/exception.c:555: warning: unused parameter 'pmc' ./src/pmc/exception.c: In function 'Parrot_Exception_nci_backtrace': ./src/pmc/exception.c:689: warning: unused parameter 'pmc' src/pmc/parrotlibrary.c ./src/pmc/parrotlibrary.c: In function 'Parrot_ParrotLibrary_destroy': ./src/pmc/parrotlibrary.c:72: warning: unused parameter 'interp' ./src/pmc/parrotlibrary.c: In function 'Parrot_ParrotLibrary_get_bool': ./src/pmc/parrotlibrary.c:83: warning: unused parameter 'interp' ./src/pmc/parrotlibrary.c: In function 'Parrot_ParrotLibrary_init': ./src/pmc/parrotlibrary.c:102: warning: unused parameter 'interp' ./src/pmc/parrotlibrary.c: In function 'Parrot_ParrotLibrary_set_pointer': ./src/pmc/parrotlibrary.c:113: warning: unused parameter 'interp' src/pmc/parrotinterpreter.c ./src/pmc/parrotinterpreter.pmc: In function 'recursion_limit': ./src/pmc/parrotinterpreter.pmc:179: warning: unused parameter 'self' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_get_integer': ./src/pmc/parrotinterpreter.c:221: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_get_integer_keyed_int': ./src/pmc/parrotinterpreter.c:230: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_get_pmc': ./src/pmc/parrotinterpreter.c:243: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_get_pmc_keyed': ./src/pmc/parrotinterpreter.c:251: warning: unused parameter 'pmc' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_get_pmc_keyed_int': ./src/pmc/parrotinterpreter.c:368: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_get_pointer': ./src/pmc/parrotinterpreter.c:386: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_init_pmc': ./src/pmc/parrotinterpreter.c:413: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_is_equal': ./src/pmc/parrotinterpreter.c:444: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_set_integer_keyed_int': ./src/pmc/parrotinterpreter.c:462: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_set_pmc': ./src/pmc/parrotinterpreter.c:478: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_set_pointer': ./src/pmc/parrotinterpreter.c:486: warning: unused parameter 'interp' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_thawfinish': ./src/pmc/parrotinterpreter.c:524: warning: unused parameter 'info' ./src/pmc/parrotinterpreter.c: In function 'Parrot_ParrotInterpreter_nci_run_gc': ./src/pmc/parrotinterpreter.c:623: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_ParrotInterpreter_nci_hll_map': ./src/pmc/parrotinterpreter.pmc:757: warning: unused variable 'pmc' ./src/pmc/parrotinterpreter.c:702: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_ParrotInterpreter_nci_stdhandle': ./src/pmc/parrotinterpreter.pmc:843: warning: unused variable 'pmc' ./src/pmc/parrotinterpreter.c:788: warning: unused parameter 'pmc' src/pmc/parrotthread.c ./src/pmc/parrotthread.pmc: In function 'stop_GC': ./src/pmc/parrotthread.pmc:49: warning: unused parameter 'parent' ./src/pmc/parrotthread.pmc:49: warning: unused parameter 'thread' src/pmc/lexpad.c ./src/pmc/lexpad.c: In function 'Parrot_LexPad_destroy': ./src/pmc/lexpad.c:53: warning: unused parameter 'interp' ./src/pmc/lexpad.c: In function 'Parrot_LexPad_init': ./src/pmc/lexpad.c:124: warning: unused parameter 'pmc' ./src/pmc/lexpad.c: In function 'Parrot_LexPad_init_pmc': ./src/pmc/lexpad.c:133: warning: unused parameter 'interp' ./src/pmc/lexpad.c: In function 'Parrot_LexPad_nci_get_lexinfo': ./src/pmc/lexpad.c:185: warning: unused parameter 'pmc' src/pmc/timer.c ./src/pmc/timer.c: In function 'Parrot_Timer_get_integer_keyed_int': ./src/pmc/timer.c:108: warning: unused parameter 'interp' ./src/pmc/timer.c: In function 'Parrot_Timer_get_number_keyed_int': ./src/pmc/timer.c:132: warning: unused parameter 'interp' ./src/pmc/timer.c: In function 'Parrot_Timer_get_pmc_keyed_int': ./src/pmc/timer.c:151: warning: unused parameter 'interp' src/pmc/pointer.c ./src/pmc/pointer.c: In function 'Parrot_Pointer_get_bool': ./src/pmc/pointer.c:57: warning: unused parameter 'interp' ./src/pmc/pointer.c: In function 'Parrot_Pointer_get_integer': ./src/pmc/pointer.c:65: warning: unused parameter 'interp' ./src/pmc/pointer.c: In function 'Parrot_Pointer_get_number': ./src/pmc/pointer.c:73: warning: unused parameter 'interp' ./src/pmc/pointer.c: In function 'Parrot_Pointer_init': ./src/pmc/pointer.c:97: warning: unused parameter 'interp' ./src/pmc/pointer.c: In function 'Parrot_Pointer_is_same': ./src/pmc/pointer.c:105: warning: unused parameter 'interp' src/pmc/sub.c ./src/pmc/sub.c: In function 'Parrot_Sub_defined': ./src/pmc/sub.c:114: warning: unused parameter 'interp' ./src/pmc/sub.c:114: warning: unused parameter 'pmc' ./src/pmc/sub.c: In function 'Parrot_Sub_get_bool': ./src/pmc/sub.c:206: warning: unused parameter 'interp' ./src/pmc/sub.c:206: warning: unused parameter 'pmc' ./src/pmc/sub.c: In function 'Parrot_Sub_get_integer_keyed': ./src/pmc/sub.c:214: warning: unused parameter 'key' ./src/pmc/sub.c: In function 'Parrot_Sub_set_pointer': ./src/pmc/sub.c:594: warning: unused parameter 'pmc' ./src/pmc/sub.c:594: warning: unused parameter 'value' ./src/pmc/sub.c: In function 'Parrot_Sub_nci_get_namespace': ./src/pmc/sub.c:696: warning: unused parameter 'pmc' ./src/pmc/sub.c: In function 'Parrot_Sub_nci___get_regs_used': ./src/pmc/sub.c:814: warning: unused parameter 'pmc' ./src/pmc/sub.c: In function 'Parrot_Sub_nci_get_lexinfo': ./src/pmc/sub.c:956: warning: unused parameter 'pmc' ./src/pmc/sub.c: In function 'Parrot_Sub_nci_get_outer': ./src/pmc/sub.c:1074: warning: unused parameter 'pmc' ./src/pmc/sub.c: In function 'Parrot_Sub_nci_set_outer': ./src/pmc/sub.c:1192: warning: unused parameter 'pmc' ./src/pmc/sub.c: In function 'Parrot_Sub_nci_get_multisig': ./src/pmc/sub.c:1294: warning: unused parameter 'pmc' ./src/pmc/sub.c: In function 'Parrot_Sub_nci_arity': ./src/pmc/sub.c:1412: warning: unused parameter 'pmc' src/pmc/continuation.c ./src/pmc/continuation.c: In function 'Parrot_Continuation_defined': ./src/pmc/continuation.c:87: warning: unused parameter 'interp' ./src/pmc/continuation.c: In function 'Parrot_Continuation_get_bool': ./src/pmc/continuation.c:119: warning: unused parameter 'interp' ./src/pmc/continuation.c: In function 'Parrot_Continuation_get_pointer': ./src/pmc/continuation.c:127: warning: unused parameter 'interp' ./src/pmc/continuation.c: In function 'Parrot_Continuation_invoke': ./src/pmc/continuation.c:164: warning: unused parameter 'next' ./src/pmc/continuation.c: In function 'Parrot_Continuation_set_pmc': ./src/pmc/continuation.c:221: warning: unused parameter 'interp' ./src/pmc/continuation.c: In function 'Parrot_Continuation_nci_caller': ./src/pmc/continuation.c:249: warning: unused parameter 'pmc' ./src/pmc/continuation.c: In function 'Parrot_Continuation_nci_continuation': ./src/pmc/continuation.c:371: warning: unused parameter 'pmc' src/pmc/retcontinuation.c ./src/pmc/retcontinuation.c: In function 'Parrot_RetContinuation_destroy': ./src/pmc/retcontinuation.c:58: warning: unused parameter 'interp' ./src/pmc/retcontinuation.c: In function 'Parrot_RetContinuation_invoke': ./src/pmc/retcontinuation.c:85: warning: unused parameter 'in_next' src/pmc/coroutine.c src/pmc/eval.c ./src/pmc/eval.pmc: In function 'clear_fixups': ./src/pmc/eval.pmc:26: warning: unused parameter 'interp' src/pmc/nci.c ./src/pmc/nci.c: In function 'Parrot_NCI_clone': ./src/pmc/nci.pmc:247: warning: unused variable 'orig_func' ./src/pmc/nci.c: In function 'Parrot_NCI_defined': ./src/pmc/nci.c:148: warning: unused parameter 'interp' ./src/pmc/nci.c: In function 'Parrot_NCI_destroy': ./src/pmc/nci.c:157: warning: unused parameter 'interp' ./src/pmc/nci.c: In function 'Parrot_NCI_get_bool': ./src/pmc/nci.c:170: warning: unused parameter 'interp' ./src/pmc/nci.c: In function 'Parrot_NCI_get_integer': ./src/pmc/nci.c:179: warning: unused parameter 'interp' ./src/pmc/nci.c: In function 'Parrot_NCI_init': ./src/pmc/nci.c:188: warning: unused parameter 'interp' ./src/pmc/nci.c: In function 'Parrot_NCI_nci_get_multisig': ./src/pmc/nci.c:309: warning: unused parameter 'pmc' ./src/pmc/nci.c: In function 'Parrot_NCI_nci_make_raw_nci': ./src/pmc/nci.c:426: warning: unused parameter 'pmc' ./src/pmc/nci.c: In function 'Parrot_NCI_nci_arity': ./src/pmc/nci.c:507: warning: unused parameter 'pmc' src/pmc/float.c ./src/pmc/float.c: In function 'Parrot_Float_destroy': ./src/pmc/float.c:82: warning: unused parameter 'interp' ./src/pmc/float.c: In function 'Parrot_Float_init': ./src/pmc/float.c:177: warning: unused parameter 'interp' ./src/pmc/float.c: In function 'Parrot_Float_nci_acos': ./src/pmc/float.c:349: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_cos': ./src/pmc/float.c:464: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_asec': ./src/pmc/float.c:580: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_asin': ./src/pmc/float.c:695: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_atan': ./src/pmc/float.c:810: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_atan2': ./src/pmc/float.c:925: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_cosh': ./src/pmc/float.c:1042: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_exp': ./src/pmc/float.c:1157: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_ln': ./src/pmc/float.c:1272: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_log10': ./src/pmc/float.c:1387: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_log2': ./src/pmc/float.c:1502: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_sec': ./src/pmc/float.c:1617: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_sech': ./src/pmc/float.c:1732: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_sin': ./src/pmc/float.c:1847: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_sinh': ./src/pmc/float.c:1962: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_tan': ./src/pmc/float.c:2077: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_tanh': ./src/pmc/float.c:2192: warning: unused parameter 'pmc' ./src/pmc/float.c: In function 'Parrot_Float_nci_sqrt': ./src/pmc/float.c:2307: warning: unused parameter 'pmc' src/pmc/integer.c ./src/pmc/integer.c: In function 'Parrot_Integer_destroy': ./src/pmc/integer.c:135: warning: unused parameter 'interp' ./src/pmc/integer.c: In function 'Parrot_Integer_i_floor_divide_float': ./src/pmc/integer.pmc:941: warning: unused variable 'self_val' ./src/pmc/integer.c: In function 'Parrot_Integer_init': ./src/pmc/integer.c:425: warning: unused parameter 'interp' ./src/pmc/integer.c: In function 'Parrot_Integer_multi_i_add_Complex': ./src/pmc/integer.pmc:446: warning: unused variable 'a' ./src/pmc/integer.c: In function 'Parrot_Integer_nci_get_as_base': ./src/pmc/integer.c:1267: warning: unused parameter 'pmc' src/pmc/bigint.c ./src/pmc/bigint.pmc: In function 'bigint_init': ./src/pmc/bigint.pmc:41: warning: unused parameter 'interp' ./src/pmc/bigint.c: In function 'Parrot_BigInt_destroy': ./src/pmc/bigint.pmc:643: warning: unused variable 'bi' ./src/pmc/bigint.c: In function 'Parrot_BigInt_get_bignum': ./src/pmc/bigint.c:702: warning: unused parameter 'interp' ./src/pmc/bigint.c: In function 'Parrot_BigInt_i_add_float': ./src/pmc/bigint.c:773: warning: unused parameter 'pmc' ./src/pmc/bigint.c:773: warning: unused parameter 'value' ./src/pmc/bigint.c: In function 'Parrot_BigInt_i_multiply_float': ./src/pmc/bigint.c:823: warning: unused parameter 'pmc' ./src/pmc/bigint.c:823: warning: unused parameter 'value' ./src/pmc/bigint.c: In function 'Parrot_BigInt_i_subtract_float': ./src/pmc/bigint.c:849: warning: unused parameter 'pmc' ./src/pmc/bigint.c:849: warning: unused parameter 'value' ./src/pmc/bigint.c: In function 'Parrot_BigInt_instantiate': ./src/pmc/bigint.c:884: warning: unused parameter 'interp' ./src/pmc/bigint.c:884: warning: unused parameter 'pmc' ./src/pmc/bigint.c:884: warning: unused parameter 'sig' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_BigInt_nci_version': ./src/pmc/bigint.pmc:1058: warning: unused variable 'pmc' ./src/pmc/bigint.c:1005: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_add_DEFAULT_PMC': ./src/pmc/bigint.c:1146: warning: unused parameter 'pmc' ./src/pmc/bigint.c:1146: warning: unused parameter 'dest' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_i_add_DEFAULT': ./src/pmc/bigint.c:1173: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_subtract_DEFAULT_PMC': ./src/pmc/bigint.c:1212: warning: unused parameter 'pmc' ./src/pmc/bigint.c:1212: warning: unused parameter 'dest' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_i_subtract_DEFAULT': ./src/pmc/bigint.c:1239: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_multiply_DEFAULT_PMC': ./src/pmc/bigint.c:1272: warning: unused parameter 'pmc' ./src/pmc/bigint.c:1272: warning: unused parameter 'dest' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_i_multiply_DEFAULT': ./src/pmc/bigint.c:1299: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_divide_BigInt_PMC': ./src/pmc/bigint.pmc:1028: warning: unused variable 'bi' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_divide_DEFAULT_PMC': ./src/pmc/bigint.c:1361: warning: unused parameter 'pmc' ./src/pmc/bigint.c:1361: warning: unused parameter 'dest' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_i_divide_DEFAULT': ./src/pmc/bigint.c:1388: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_floor_divide_DEFAULT_PMC': ./src/pmc/bigint.c:1421: warning: unused parameter 'pmc' ./src/pmc/bigint.c:1421: warning: unused parameter 'dest' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_i_floor_divide_DEFAULT': ./src/pmc/bigint.c:1448: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_modulus_DEFAULT_PMC': ./src/pmc/bigint.c:1487: warning: unused parameter 'pmc' ./src/pmc/bigint.c:1487: warning: unused parameter 'dest' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_i_modulus_DEFAULT': ./src/pmc/bigint.c:1514: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_cmp_DEFAULT': ./src/pmc/bigint.c:1541: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_is_equal_DEFAULT': ./src/pmc/bigint.c:1568: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_bitwise_shl_DEFAULT_PMC': ./src/pmc/bigint.c:1610: warning: unused parameter 'pmc' ./src/pmc/bigint.c:1610: warning: unused parameter 'dest' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_i_bitwise_shl_DEFAULT': ./src/pmc/bigint.c:1640: warning: unused parameter 'pmc' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_bitwise_shr_DEFAULT_PMC': ./src/pmc/bigint.c:1682: warning: unused parameter 'pmc' ./src/pmc/bigint.c:1682: warning: unused parameter 'dest' ./src/pmc/bigint.c: In function 'Parrot_BigInt_multi_i_bitwise_shr_DEFAULT': ./src/pmc/bigint.c:1712: warning: unused parameter 'pmc' src/pmc/bignum.c ./src/pmc/bignum.pmc: In function 'bignum_init': ./src/pmc/bignum.pmc:157: warning: unused parameter 'interp' ./src/pmc/bignum.pmc: In function 'bignum_get_string_size': ./src/pmc/bignum.pmc:297: warning: unused variable 'n' ./src/pmc/bignum.pmc: In function 'bignum_get_default_prec': ./src/pmc/bignum.pmc:567: warning: unused parameter 'interp' ./src/pmc/bignum.pmc:567: warning: unused parameter 'self' ./src/pmc/bignum.pmc: In function 'bignum_set_default_prec': ./src/pmc/bignum.pmc:572: warning: unused parameter 'interp' ./src/pmc/bignum.pmc:572: warning: unused parameter 'self' ./src/pmc/bignum.c: In function 'Parrot_BigNum_destroy': ./src/pmc/bignum.pmc:854: warning: unused variable 'bn' ./src/pmc/bignum.c: In function 'Parrot_BigNum_get_bignum': ./src/pmc/bignum.c:888: warning: unused parameter 'interp' ./src/pmc/bignum.c: In function 'Parrot_BigNum_i_add_float': ./src/pmc/bignum.c:959: warning: unused parameter 'pmc' ./src/pmc/bignum.c:959: warning: unused parameter 'value' ./src/pmc/bignum.c: In function 'Parrot_BigNum_i_multiply_float': ./src/pmc/bignum.c:993: warning: unused parameter 'pmc' ./src/pmc/bignum.c:993: warning: unused parameter 'value' ./src/pmc/bignum.c: In function 'Parrot_BigNum_i_subtract_float': ./src/pmc/bignum.c:1019: warning: unused parameter 'pmc' ./src/pmc/bignum.c:1019: warning: unused parameter 'value' ./src/pmc/bignum.c: In function 'Parrot_BigNum_instantiate': ./src/pmc/bignum.c:1054: warning: unused parameter 'pmc' ./src/pmc/bignum.c:1054: warning: unused parameter 'sig' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_BigNum_nci_version': ./src/pmc/bignum.pmc:1227: warning: unused variable 'pmc' ./src/pmc/bignum.c:1174: warning: unused parameter 'pmc' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_add_DEFAULT_PMC': ./src/pmc/bignum.c:1315: warning: unused parameter 'pmc' ./src/pmc/bignum.c:1315: warning: unused parameter 'dest' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_i_add_DEFAULT': ./src/pmc/bignum.c:1342: warning: unused parameter 'pmc' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_subtract_DEFAULT_PMC': ./src/pmc/bignum.c:1381: warning: unused parameter 'pmc' ./src/pmc/bignum.c:1381: warning: unused parameter 'dest' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_i_subtract_DEFAULT': ./src/pmc/bignum.c:1408: warning: unused parameter 'pmc' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_multiply_DEFAULT_PMC': ./src/pmc/bignum.c:1441: warning: unused parameter 'pmc' ./src/pmc/bignum.c:1441: warning: unused parameter 'dest' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_i_multiply_DEFAULT': ./src/pmc/bignum.c:1476: warning: unused parameter 'pmc' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_divide_BigNum_PMC': ./src/pmc/bignum.pmc:1330: warning: unused variable 'bn' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_divide_DEFAULT_PMC': ./src/pmc/bignum.c:1538: warning: unused parameter 'pmc' ./src/pmc/bignum.c:1538: warning: unused parameter 'dest' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_i_divide_DEFAULT': ./src/pmc/bignum.c:1565: warning: unused parameter 'pmc' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_floor_divide_DEFAULT_PMC': ./src/pmc/bignum.c:1598: warning: unused parameter 'pmc' ./src/pmc/bignum.c:1598: warning: unused parameter 'dest' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_i_floor_divide_DEFAULT': ./src/pmc/bignum.c:1625: warning: unused parameter 'pmc' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_cmp_DEFAULT': ./src/pmc/bignum.c:1652: warning: unused parameter 'pmc' ./src/pmc/bignum.c: In function 'Parrot_BigNum_multi_is_equal_DEFAULT': ./src/pmc/bignum.c:1679: warning: unused parameter 'pmc' ./src/pmc/bignum.pmc: At top level: ./src/pmc/bignum.pmc:199: warning: 'bignum_set_ui' defined but not used ./src/pmc/bignum.pmc:206: warning: 'bignum_set_float' defined but not used ./src/pmc/bignum.pmc:262: warning: 'bignum_get_ui' defined but not used ./src/pmc/bignum.pmc:295: warning: 'bignum_get_string_size' defined but not used ./src/pmc/bignum.pmc:314: warning: 'bignum_get_float' defined but not used ./src/pmc/bignum.pmc:478: warning: 'bignum_div_bignum_float' defined but not used ./src/pmc/bignum.pmc:528: warning: 'bignum_cmp_double' defined but not used ./src/pmc/bignum.pmc:542: warning: 'bignum_cmp_ulong' defined but not used ./src/pmc/bignum.pmc:567: warning: 'bignum_get_default_prec' defined but not used ./src/pmc/bignum.pmc:572: warning: 'bignum_set_default_prec' defined but not used src/pmc/complex.c ./src/pmc/complex.c: In function 'Parrot_Complex_destroy': ./src/pmc/complex.c:299: warning: unused parameter 'interp' ./src/pmc/complex.c: In function 'Parrot_Complex_instantiate': ./src/pmc/complex.c:656: warning: unused parameter 'interp' ./src/pmc/complex.c:656: warning: unused parameter 'pmc' ./src/pmc/complex.c:656: warning: unused parameter 'sig' ./src/pmc/complex.c: In function 'Parrot_Complex_invoke': ./src/pmc/complex.c:707: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_ln': ./src/pmc/complex.c:1246: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_exp': ./src/pmc/complex.c:1377: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_sin': ./src/pmc/complex.c:1507: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_cos': ./src/pmc/complex.c:1646: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_tan': ./src/pmc/complex.c:1780: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_cot': ./src/pmc/complex.c:1907: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_sec': ./src/pmc/complex.c:2033: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_csc': ./src/pmc/complex.c:2157: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_asin': ./src/pmc/complex.c:2283: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_acos': ./src/pmc/complex.c:2426: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_atan': ./src/pmc/complex.c:2569: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_acot': ./src/pmc/complex.c:2705: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_acsc': ./src/pmc/complex.c:2831: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_asec': ./src/pmc/complex.c:2957: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_sinh': ./src/pmc/complex.c:3083: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_cosh': ./src/pmc/complex.c:3204: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_tanh': ./src/pmc/complex.c:3330: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_coth': ./src/pmc/complex.c:3457: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_csch': ./src/pmc/complex.c:3583: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_sech': ./src/pmc/complex.c:3709: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_asinh': ./src/pmc/complex.c:3835: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_acosh': ./src/pmc/complex.c:3966: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_atanh': ./src/pmc/complex.c:4092: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_acoth': ./src/pmc/complex.c:4223: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_acsch': ./src/pmc/complex.c:4349: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_asech': ./src/pmc/complex.c:4475: warning: unused parameter 'pmc' ./src/pmc/complex.c: In function 'Parrot_Complex_nci_sqrt': ./src/pmc/complex.c:4643: warning: unused parameter 'pmc' src/pmc/string.c ./src/pmc/string.c: In function 'Parrot_String_destroy': ./src/pmc/string.c:220: warning: unused parameter 'interp' ./src/pmc/string.c: In function 'Parrot_String_nci_replace': ./src/pmc/string.c:643: warning: unused parameter 'pmc' ./src/pmc/string.c: In function 'Parrot_String_nci_to_int': ./src/pmc/string.c:736: warning: unused parameter 'pmc' ./src/pmc/string.c: In function 'Parrot_String_nci_lower': ./src/pmc/string.c:890: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_String_nci_trans': ./src/pmc/string.pmc:1061: warning: unused variable 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm:471: warning: label 'trans_returns' defined but not used ./src/pmc/string.c:1006: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_String_nci_reverse': ./src/pmc/string.pmc:1182: warning: unused variable 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm:471: warning: label 'reverse_returns' defined but not used ./src/pmc/string.c:1128: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_String_nci_is_integer': ./src/pmc/string.pmc:1298: warning: unused variable 'pmc' ./src/pmc/string.c:1244: warning: unused parameter 'pmc' ./src/pmc/string.c: In function 'Parrot_String_nci_reverse_index': ./src/pmc/string.c:1448: warning: unused parameter 'pmc' src/pmc/boolean.c ./src/pmc/boolean.c: In function 'Parrot_Boolean_instantiate': ./src/pmc/boolean.pmc:41: warning: unused variable 'res' ./src/pmc/boolean.c:57: warning: unused parameter 'sig' src/pmc/ref.c ./src/pmc/ref.c: In function 'Parrot_Ref_get_pmc': ./src/pmc/ref.c:757: warning: unused parameter 'interp' ./src/pmc/ref.c: In function 'Parrot_Ref_init_pmc': ./src/pmc/ref.c:1340: warning: unused parameter 'interp' src/pmc/sharedref.c ./src/pmc/sharedref.c: In function 'Parrot_SharedRef_get_pmc': ./src/pmc/sharedref.c:778: warning: unused parameter 'pmc' ./src/pmc/sharedref.c: In function 'Parrot_SharedRef_share': ./src/pmc/sharedref.c:2054: warning: unused parameter 'interp' ./src/pmc/sharedref.c:2054: warning: unused parameter 'pmc' src/pmc/array.c ./src/pmc/array.c: In function 'Parrot_Array_elements': ./src/pmc/array.c:213: warning: unused parameter 'interp' src/pmc/fixedintegerarray.c ./src/pmc/fixedintegerarray.c: In function 'Parrot_FixedIntegerArray_get_integer': ./src/pmc/fixedintegerarray.c:127: warning: unused parameter 'interp' ./src/pmc/fixedintegerarray.c: In function 'Parrot_FixedIntegerArray_init': ./src/pmc/fixedintegerarray.c:237: warning: unused parameter 'interp' ./src/pmc/fixedintegerarray.c: In function 'Parrot_FixedIntegerArray_nci_sort': ./src/pmc/fixedintegerarray.c:463: warning: unused parameter 'pmc' src/pmc/iterator.c ./src/pmc/iterator.c: In function 'Parrot_Iterator_destroy': ./src/pmc/iterator.c:133: warning: unused parameter 'interp' ./src/pmc/iterator.c: In function 'Parrot_Iterator_get_iter': ./src/pmc/iterator.c:209: warning: unused parameter 'interp' ./src/pmc/iterator.c: In function 'Parrot_Iterator_init': ./src/pmc/iterator.c:300: warning: unused parameter 'pmc' ./src/pmc/iterator.c: In function 'Parrot_Iterator_nci_set_key': ./src/pmc/iterator.c:556: warning: unused parameter 'pmc' ./src/pmc/iterator.c: In function 'Parrot_Iterator_nci_get_key': ./src/pmc/iterator.c:637: warning: unused parameter 'pmc' src/pmc/fixedstringarray.c ./src/pmc/fixedstringarray.c: In function 'Parrot_FixedStringArray_init': ./src/pmc/fixedstringarray.c:261: warning: unused parameter 'interp' src/pmc/hash.c ./src/pmc/hash.pmc: In function 'get_integer_pmc': ./src/pmc/hash.pmc:37: warning: unused parameter 'base_type' ./src/pmc/hash.pmc: In function 'get_number_pmc': ./src/pmc/hash.pmc:54: warning: unused parameter 'base_type' ./src/pmc/hash.pmc: In function 'get_string_pmc': ./src/pmc/hash.pmc:70: warning: unused parameter 'base_type' ./src/pmc/hash.c: In function 'Parrot_Hash_is_same': ./src/pmc/hash.c:679: warning: unused parameter 'interp' src/pmc/orderedhash.c ./src/pmc/orderedhash.c: In function 'Parrot_OrderedHash_delete_keyed_int': ./src/pmc/orderedhash.c:174: warning: unused parameter 'interp' ./src/pmc/orderedhash.c: In function 'Parrot_OrderedHash_exists_keyed_int': ./src/pmc/orderedhash.c:248: warning: unused parameter 'interp' src/pmc/os.c ./src/pmc/os.c: In function 'Parrot_OS_get_pointer': ./src/pmc/os.c:66: warning: unused parameter 'interp' ./src/pmc/os.c:66: warning: unused parameter 'pmc' ./src/pmc/os.c: In function 'Parrot_OS_set_pointer': ./src/pmc/os.c:74: warning: unused parameter 'interp' ./src/pmc/os.c:74: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_cwd': ./src/pmc/os.pmc:135: warning: unused variable 'pmc' ./src/pmc/os.c:82: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_chdir': ./src/pmc/os.pmc:270: warning: unused variable 'pmc' ./src/pmc/os.c:216: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_rm': ./src/pmc/os.pmc:363: warning: unused variable 'pmc' ./src/pmc/os.c:309: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_mkdir': ./src/pmc/os.pmc:477: warning: unused variable 'pmc' ./src/pmc/os.c:422: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_stat': ./src/pmc/os.pmc:571: warning: unused variable 'pmc' ./src/pmc/os.c:517: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_lstat': ./src/pmc/os.pmc:730: warning: unused variable 'pmc' ./src/pmc/os.c:676: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_symlink': ./src/pmc/os.pmc:894: warning: unused variable 'pmc' ./src/pmc/os.c:839: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_link': ./src/pmc/os.pmc:993: warning: unused variable 'pmc' ./src/pmc/os.c:938: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_umask': ./src/pmc/os.pmc:1091: warning: unused variable 'pmc' ./src/pmc/os.c:1037: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_chroot': ./src/pmc/os.pmc:1213: warning: unused variable 'pmc' ./src/pmc/os.c:1159: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_readdir': ./src/pmc/os.pmc:1308: warning: unused variable 'pmc' ./src/pmc/os.c:1254: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_OS_nci_rename': ./src/pmc/os.pmc:1452: warning: unused variable 'pmc' ./src/pmc/os.c:1397: warning: unused parameter 'pmc' src/pmc/file.c ./src/pmc/file.c: In function 'Parrot_File_get_pointer': ./src/pmc/file.c:58: warning: unused parameter 'interp' ./src/pmc/file.c:58: warning: unused parameter 'pmc' ./src/pmc/file.c: In function 'Parrot_File_set_pointer': ./src/pmc/file.c:66: warning: unused parameter 'interp' ./src/pmc/file.c:66: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_File_nci_exists': ./src/pmc/file.pmc:128: warning: unused variable 'pmc' ./src/pmc/file.c:74: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_File_nci_is_dir': ./src/pmc/file.pmc:277: warning: unused variable 'pmc' ./src/pmc/file.c:223: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_File_nci_is_file': ./src/pmc/file.pmc:432: warning: unused variable 'pmc' ./src/pmc/file.c:378: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_File_nci_is_link': ./src/pmc/file.pmc:587: warning: unused variable 'pmc' ./src/pmc/file.c:533: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_File_nci_copy': ./src/pmc/file.pmc:768: warning: unused variable 'pmc' ./src/pmc/file.c:713: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_File_nci_rename': ./src/pmc/file.pmc:893: warning: unused variable 'pmc' ./src/pmc/file.c:838: warning: unused parameter 'pmc' src/pmc/addrregistry.c src/pmc/bound_nci.c ./src/pmc/bound_nci.c: In function 'Parrot_Bound_NCI_get_pmc': ./src/pmc/bound_nci.c:46: warning: unused parameter 'interp' ./src/pmc/bound_nci.c: In function 'Parrot_Bound_NCI_set_pmc': ./src/pmc/bound_nci.c:113: warning: unused parameter 'interp' src/pmc/callsignature.c ./src/pmc/callsignature.c: In function 'Parrot_CallSignature_get_attr_str': ./src/pmc/callsignature.c:54: warning: unused parameter 'interp' ./src/pmc/callsignature.c:54: warning: unused parameter 'key' ./src/pmc/callsignature.c: In function 'Parrot_CallSignature_get_string': ./src/pmc/callsignature.c:81: warning: unused parameter 'interp' ./src/pmc/callsignature.c: In function 'Parrot_CallSignature_init': ./src/pmc/callsignature.c:90: warning: unused parameter 'interp' ./src/pmc/callsignature.c: In function 'Parrot_CallSignature_set_attr_str': ./src/pmc/callsignature.c:139: warning: unused parameter 'interp' ./src/pmc/callsignature.c:139: warning: unused parameter 'key' ./src/pmc/callsignature.c: In function 'Parrot_CallSignature_set_pmc': ./src/pmc/callsignature.c:148: warning: unused parameter 'interp' ./src/pmc/callsignature.c: In function 'Parrot_CallSignature_set_string_native': ./src/pmc/callsignature.c:157: warning: unused parameter 'interp' src/pmc/capture.c ./src/pmc/capture.c: In function 'Parrot_Capture_destroy': ./src/pmc/capture.c:112: warning: unused parameter 'interp' ./src/pmc/capture.c: In function 'Parrot_Capture_init': ./src/pmc/capture.c:249: warning: unused parameter 'interp' ./src/pmc/capture.c: In function 'Parrot_Capture_nci_list': ./src/pmc/capture.c:518: warning: unused parameter 'pmc' ./src/pmc/capture.c: In function 'Parrot_Capture_nci_hash': ./src/pmc/capture.c:645: warning: unused parameter 'pmc' src/pmc/class.c ./src/pmc/class.c: In function 'Parrot_Class_destroy': ./src/pmc/class.c:640: warning: unused parameter 'interp' ./src/pmc/class.c: In function 'Parrot_Class_get_integer': ./src/pmc/class.c:748: warning: unused parameter 'interp' ./src/pmc/class.c: In function 'Parrot_Class_thawfinish': ./src/pmc/class.c:1322: warning: unused parameter 'info' ./src/pmc/class.c: In function 'Parrot_Class_type': ./src/pmc/class.c:1337: warning: unused parameter 'interp' ./src/pmc/class.c: In function 'Parrot_Class_nci_name': ./src/pmc/class.c:1385: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_get_namespace': ./src/pmc/class.c:1516: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_resolve_method': ./src/pmc/class.c:1637: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_new': ./src/pmc/class.c:1762: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_attributes': ./src/pmc/class.c:1884: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_add_attribute': ./src/pmc/class.c:2000: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_methods': ./src/pmc/class.c:2086: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_add_method': ./src/pmc/class.c:2201: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_add_vtable_override': ./src/pmc/class.c:2302: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_remove_method': ./src/pmc/class.c:2385: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_find_method': ./src/pmc/class.c:2466: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_parents': ./src/pmc/class.c:2622: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_add_parent': ./src/pmc/class.c:2737: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_roles': ./src/pmc/class.c:2818: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_add_role': ./src/pmc/class.c:2933: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_inspect': ./src/pmc/class.c:3052: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_isa': ./src/pmc/class.c:3177: warning: unused parameter 'pmc' ./src/pmc/class.c: In function 'Parrot_Class_nci_does': ./src/pmc/class.c:3294: warning: unused parameter 'pmc' src/pmc/codestring.c ./src/pmc/codestring.c: In function 'Parrot_CodeString_nci_emit': ./src/pmc/codestring.c:59: warning: unused parameter 'pmc' ./src/pmc/codestring.c: In function 'Parrot_CodeString_nci_unique': ./src/pmc/codestring.c:237: warning: unused parameter 'pmc' ./src/pmc/codestring.c: In function 'Parrot_CodeString_nci_escape': ./src/pmc/codestring.c:389: warning: unused parameter 'pmc' ./src/pmc/codestring.c: In function 'Parrot_CodeString_nci_key': ./src/pmc/codestring.c:531: warning: unused parameter 'pmc' src/pmc/cpointer.c ./src/pmc/cpointer.c: In function 'Parrot_CPointer_destroy': ./src/pmc/cpointer.c:83: warning: unused parameter 'interp' ./src/pmc/cpointer.c: In function 'Parrot_CPointer_get_bool': ./src/pmc/cpointer.c:96: warning: unused parameter 'interp' ./src/pmc/cpointer.c: In function 'Parrot_CPointer_get_pointer': ./src/pmc/cpointer.c:159: warning: unused parameter 'interp' ./src/pmc/cpointer.c: In function 'Parrot_CPointer_get_string_keyed_str': ./src/pmc/cpointer.c:187: warning: unused parameter 'interp' ./src/pmc/cpointer.c:187: warning: unused parameter 'key' ./src/pmc/cpointer.c: In function 'Parrot_CPointer_init': ./src/pmc/cpointer.c:196: warning: unused parameter 'interp' ./src/pmc/cpointer.c: In function 'Parrot_CPointer_set_pointer': ./src/pmc/cpointer.c:304: warning: unused parameter 'interp' ./src/pmc/cpointer.c: In function 'Parrot_CPointer_set_string_keyed_str': ./src/pmc/cpointer.c:313: warning: unused parameter 'interp' ./src/pmc/cpointer.c:313: warning: unused parameter 'key' src/pmc/eventhandler.c ./src/pmc/eventhandler.c: In function 'Parrot_EventHandler_destroy': ./src/pmc/eventhandler.c:47: warning: unused parameter 'interp' ./src/pmc/eventhandler.c: In function 'Parrot_EventHandler_init': ./src/pmc/eventhandler.c:90: warning: unused parameter 'interp' ./src/pmc/eventhandler.c: In function 'Parrot_EventHandler_invoke': ./src/pmc/eventhandler.c:145: warning: unused parameter 'interp' ./src/pmc/eventhandler.c: In function 'Parrot_EventHandler_set_integer_native': ./src/pmc/eventhandler.c:183: warning: unused parameter 'interp' ./src/pmc/eventhandler.c: In function 'Parrot_EventHandler_set_pmc': ./src/pmc/eventhandler.c:194: warning: unused parameter 'interp' ./src/pmc/eventhandler.c: In function 'Parrot_EventHandler_nci_can_handle': ./src/pmc/eventhandler.c:206: warning: unused parameter 'pmc' src/pmc/exceptionhandler.c ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_destroy': ./src/pmc/exceptionhandler.c:59: warning: unused parameter 'interp' ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_get_integer': ./src/pmc/exceptionhandler.c:79: warning: unused parameter 'interp' ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_invoke': ./src/pmc/exceptionhandler.c:113: warning: unused parameter 'next' ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_set_integer_native': ./src/pmc/exceptionhandler.c:144: warning: unused parameter 'interp' ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_nci_can_handle': ./src/pmc/exceptionhandler.c:153: warning: unused parameter 'pmc' ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_nci_min_severity': ./src/pmc/exceptionhandler.c:500: warning: unused parameter 'pmc' ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_nci_max_severity': ./src/pmc/exceptionhandler.c:625: warning: unused parameter 'pmc' ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_nci_handle_types': ./src/pmc/exceptionhandler.c:750: warning: unused parameter 'pmc' ./src/pmc/exceptionhandler.c: In function 'Parrot_ExceptionHandler_nci_handle_types_except': ./src/pmc/exceptionhandler.c:836: warning: unused parameter 'pmc' src/pmc/exporter.c ./src/pmc/exporter.c: In function 'Parrot_Exporter_destroy': ./src/pmc/exporter.c:117: warning: unused parameter 'interp' ./src/pmc/exporter.c: In function 'Parrot_Exporter_nci_source': ./src/pmc/exporter.c:159: warning: unused parameter 'pmc' ./src/pmc/exporter.c: In function 'Parrot_Exporter_nci_destination': ./src/pmc/exporter.c:287: warning: unused parameter 'pmc' ./src/pmc/exporter.c: In function 'Parrot_Exporter_nci_globals': ./src/pmc/exporter.c:416: warning: unused parameter 'pmc' ./src/pmc/exporter.c: In function 'Parrot_Exporter_nci_import': ./src/pmc/exporter.c:608: warning: unused parameter 'pmc' src/pmc/filehandle.c ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_init': ./src/pmc/filehandle.c:102: warning: unused parameter 'interp' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_open': ./src/pmc/filehandle.c:153: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_isatty': ./src/pmc/filehandle.c:313: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_close': ./src/pmc/filehandle.c:427: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_is_closed': ./src/pmc/filehandle.c:542: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_read': ./src/pmc/filehandle.c:657: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_readline': ./src/pmc/filehandle.c:787: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_FileHandle_nci_readline_interactive': ./src/pmc/filehandle.pmc:961: warning: unused variable 'pmc' ./src/pmc/filehandle.c:906: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_readall': ./src/pmc/filehandle.c:1149: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_flush': ./src/pmc/filehandle.c:1329: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_print': ./src/pmc/filehandle.c:1408: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_puts': ./src/pmc/filehandle.c:1491: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_buffer_type': ./src/pmc/filehandle.c:1652: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_buffer_size': ./src/pmc/filehandle.c:1835: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_mode': ./src/pmc/filehandle.c:1961: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_encoding': ./src/pmc/filehandle.c:2080: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_eof': ./src/pmc/filehandle.c:2234: warning: unused parameter 'pmc' ./src/pmc/filehandle.c: In function 'Parrot_FileHandle_nci_get_fd': ./src/pmc/filehandle.c:2399: warning: unused parameter 'pmc' src/pmc/fixedbooleanarray.c ./src/pmc/fixedbooleanarray.c: In function 'Parrot_FixedBooleanArray_init': ./src/pmc/fixedbooleanarray.c:245: warning: unused parameter 'interp' ./src/pmc/fixedbooleanarray.c: In function 'Parrot_FixedBooleanArray_nci_fill': ./src/pmc/fixedbooleanarray.c:397: warning: unused parameter 'pmc' src/pmc/fixedfloatarray.c ./src/pmc/fixedfloatarray.c: In function 'Parrot_FixedFloatArray_init': ./src/pmc/fixedfloatarray.c:195: warning: unused parameter 'interp' src/pmc/fixedpmcarray.c ./src/pmc/fixedpmcarray.c: In function 'Parrot_FixedPMCArray_destroy': ./src/pmc/fixedpmcarray.c:85: warning: unused parameter 'interp' ./src/pmc/fixedpmcarray.c: In function 'Parrot_FixedPMCArray_elements': ./src/pmc/fixedpmcarray.c:96: warning: unused parameter 'interp' ./src/pmc/fixedpmcarray.c: In function 'Parrot_FixedPMCArray_init': ./src/pmc/fixedpmcarray.c:310: warning: unused parameter 'interp' ./src/pmc/fixedpmcarray.c: In function 'Parrot_FixedPMCArray_nci_sort': ./src/pmc/fixedpmcarray.c:603: warning: unused parameter 'pmc' src/pmc/lexinfo.c ./src/pmc/lexinfo.c: In function 'Parrot_LexInfo_init': ./src/pmc/lexinfo.c:79: warning: unused parameter 'pmc' ./src/pmc/lexinfo.c: In function 'Parrot_LexInfo_nci_declare_lex_preg': ./src/pmc/lexinfo.c:177: warning: unused parameter 'pmc' src/pmc/multisub.c ./src/pmc/multisub.c: In function 'Parrot_MultiSub_set_integer_keyed_int': ./src/pmc/multisub.c:100: warning: unused parameter 'pmc' ./src/pmc/multisub.c:100: warning: unused parameter 'key' ./src/pmc/multisub.c:100: warning: unused parameter 'value' ./src/pmc/multisub.c: In function 'Parrot_MultiSub_set_number_keyed_int': ./src/pmc/multisub.c:109: warning: unused parameter 'pmc' ./src/pmc/multisub.c:109: warning: unused parameter 'key' ./src/pmc/multisub.c:109: warning: unused parameter 'value' ./src/pmc/multisub.c: In function 'Parrot_MultiSub_set_string_keyed_int': ./src/pmc/multisub.c:130: warning: unused parameter 'pmc' ./src/pmc/multisub.c:130: warning: unused parameter 'key' ./src/pmc/multisub.c:130: warning: unused parameter 'value' ./src/pmc/multisub.pmc: In function 'Parrot_MultiSub_nci_get_iter': ./src/pmc/multisub.pmc:110: warning: unused variable 's' ./src/pmc/multisub.pmc:193: warning: unused variable 'pmc' ./src/pmc/multisub.c:139: warning: unused parameter 'pmc' src/pmc/namespace.c ./src/pmc/namespace.c: In function 'Parrot_NameSpace_get_class': ./src/pmc/namespace.c:155: warning: unused parameter 'interp' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_get_string': ./src/pmc/namespace.c:297: warning: unused parameter 'interp' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_make_namespace': ./src/pmc/namespace.c:491: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_add_namespace': ./src/pmc/namespace.c:610: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_add_sub': ./src/pmc/namespace.c:700: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_add_var': ./src/pmc/namespace.c:791: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_get_name': ./src/pmc/namespace.c:874: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_find_namespace': ./src/pmc/namespace.c:1002: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_find_sub': ./src/pmc/namespace.c:1172: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_find_var': ./src/pmc/namespace.c:1342: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_del_namespace': /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm:471: warning: label 'del_namespace_returns' defined but not used ./src/pmc/namespace.c:1484: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_del_sub': /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm:471: warning: label 'del_sub_returns' defined but not used ./src/pmc/namespace.c:1594: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_del_var': ./src/pmc/namespace.c:1704: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_get_sym': ./src/pmc/namespace.c:1785: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_export_to': ./src/pmc/namespace.c:1957: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_get_parent': ./src/pmc/namespace.c:2109: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_get_class': ./src/pmc/namespace.c:2223: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_set_class': ./src/pmc/namespace.c:2342: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_get_associated_methods': ./src/pmc/namespace.c:2423: warning: unused parameter 'pmc' ./src/pmc/namespace.c: In function 'Parrot_NameSpace_nci_get_associated_vtable_methods': ./src/pmc/namespace.c:2541: warning: unused parameter 'pmc' src/pmc/object.c ./src/pmc/object.c: In function 'Parrot_Object_destroy': ./src/pmc/object.c:1775: warning: unused parameter 'interp' ./src/pmc/object.c: In function 'Parrot_Object_init': ./src/pmc/object.c:4669: warning: unused parameter 'pmc' ./src/pmc/object.c: In function 'Parrot_Object_init_pmc': ./src/pmc/object.c:4678: warning: unused parameter 'pmc' ./src/pmc/object.c:4678: warning: unused parameter 'worreva' ./src/pmc/object.c: In function 'Parrot_Object_thawfinish': ./src/pmc/object.c:7549: warning: unused parameter 'interp' ./src/pmc/object.c:7549: warning: unused parameter 'info' src/pmc/packfile.c ./src/pmc/packfile.c: In function 'Parrot_Packfile_nci_get_directory': ./src/pmc/packfile.c:196: warning: unused parameter 'pmc' src/pmc/packfileannotation.c ./src/pmc/packfileannotation.c: In function 'Parrot_PackfileAnnotation_get_integer': ./src/pmc/packfileannotation.c:45: warning: unused parameter 'pmc' src/pmc/packfileannotationkeys.c ./src/pmc/packfileannotationkeys.c: In function 'Parrot_PackfileAnnotationKeys_get_integer_keyed_int': ./src/pmc/packfileannotationkeys.c:50: warning: unused parameter 'pmc' ./src/pmc/packfileannotationkeys.c:50: warning: unused parameter 'index' ./src/pmc/packfileannotationkeys.c: In function 'Parrot_PackfileAnnotationKeys_get_string_keyed_int': ./src/pmc/packfileannotationkeys.c:58: warning: unused parameter 'pmc' ./src/pmc/packfileannotationkeys.c:58: warning: unused parameter 'index' ./src/pmc/packfileannotationkeys.c: In function 'Parrot_PackfileAnnotationKeys_set_integer_keyed_int': ./src/pmc/packfileannotationkeys.c:66: warning: unused parameter 'pmc' ./src/pmc/packfileannotationkeys.c:66: warning: unused parameter 'index' ./src/pmc/packfileannotationkeys.c:66: warning: unused parameter 'value' ./src/pmc/packfileannotationkeys.c: In function 'Parrot_PackfileAnnotationKeys_set_string_keyed_int': ./src/pmc/packfileannotationkeys.c:74: warning: unused parameter 'pmc' ./src/pmc/packfileannotationkeys.c:74: warning: unused parameter 'index' ./src/pmc/packfileannotationkeys.c:74: warning: unused parameter 'value' src/pmc/packfileannotations.c ./src/pmc/packfileannotations.c: In function 'Parrot_PackfileAnnotations_elements': ./src/pmc/packfileannotations.c:52: warning: unused parameter 'pmc' ./src/pmc/packfileannotations.c: In function 'Parrot_PackfileAnnotations_get_pmc_keyed_int': ./src/pmc/packfileannotations.c:60: warning: unused parameter 'pmc' ./src/pmc/packfileannotations.c:60: warning: unused parameter 'index' ./src/pmc/packfileannotations.c: In function 'Parrot_PackfileAnnotations_set_pmc_keyed_int': ./src/pmc/packfileannotations.c:68: warning: unused parameter 'pmc' ./src/pmc/packfileannotations.c:68: warning: unused parameter 'index' ./src/pmc/packfileannotations.c:68: warning: unused parameter 'annotation' src/pmc/packfileconstanttable.c ./src/pmc/packfileconstanttable.c: In function 'Parrot_PackfileConstantTable_elements': ./src/pmc/packfileconstanttable.c:66: warning: unused parameter 'interp' ./src/pmc/packfileconstanttable.c: In function 'Parrot_PackfileConstantTable_set_number_keyed_int': ./src/pmc/packfileconstanttable.c:105: warning: unused parameter 'pmc' ./src/pmc/packfileconstanttable.c:105: warning: unused parameter 'index' ./src/pmc/packfileconstanttable.c:105: warning: unused parameter 'value' ./src/pmc/packfileconstanttable.c: In function 'Parrot_PackfileConstantTable_set_pmc_keyed_int': ./src/pmc/packfileconstanttable.c:113: warning: unused parameter 'pmc' ./src/pmc/packfileconstanttable.c:113: warning: unused parameter 'index' ./src/pmc/packfileconstanttable.c:113: warning: unused parameter 'value' ./src/pmc/packfileconstanttable.c: In function 'Parrot_PackfileConstantTable_set_string_keyed_int': ./src/pmc/packfileconstanttable.c:121: warning: unused parameter 'pmc' ./src/pmc/packfileconstanttable.c:121: warning: unused parameter 'index' ./src/pmc/packfileconstanttable.c:121: warning: unused parameter 'value' ./src/pmc/packfileconstanttable.c: In function 'Parrot_PackfileConstantTable_nci_get_type': ./src/pmc/packfileconstanttable.c:129: warning: unused parameter 'pmc' src/pmc/packfiledirectory.c ./src/pmc/packfiledirectory.c: In function 'Parrot_PackfileDirectory_elements': ./src/pmc/packfiledirectory.c:52: warning: unused parameter 'interp' src/pmc/packfilefixupentry.c ./src/pmc/packfilefixupentry.c: In function 'Parrot_PackfileFixupEntry_get_integer': ./src/pmc/packfilefixupentry.c:46: warning: unused parameter 'interp' ./src/pmc/packfilefixupentry.c: In function 'Parrot_PackfileFixupEntry_set_integer_native': ./src/pmc/packfilefixupentry.c:64: warning: unused parameter 'pmc' ./src/pmc/packfilefixupentry.c:64: warning: unused parameter 'offset' ./src/pmc/packfilefixupentry.c: In function 'Parrot_PackfileFixupEntry_set_string_native': ./src/pmc/packfilefixupentry.c:72: warning: unused parameter 'pmc' ./src/pmc/packfilefixupentry.c:72: warning: unused parameter 'value' ./src/pmc/packfilefixupentry.c: In function 'Parrot_PackfileFixupEntry_nci_get_type': ./src/pmc/packfilefixupentry.c:80: warning: unused parameter 'pmc' src/pmc/packfilefixuptable.c ./src/pmc/packfilefixuptable.c: In function 'Parrot_PackfileFixupTable_elements': ./src/pmc/packfilefixuptable.c:51: warning: unused parameter 'interp' ./src/pmc/packfilefixuptable.c: In function 'Parrot_PackfileFixupTable_set_pmc_keyed_int': ./src/pmc/packfilefixuptable.c:75: warning: unused parameter 'pmc' ./src/pmc/packfilefixuptable.c:75: warning: unused parameter 'index' ./src/pmc/packfilefixuptable.c:75: warning: unused parameter 'value' src/pmc/packfilerawsegment.c ./src/pmc/packfilerawsegment.c: In function 'Parrot_PackfileRawSegment_elements': ./src/pmc/packfilerawsegment.c:51: warning: unused parameter 'interp' ./src/pmc/packfilerawsegment.c: In function 'Parrot_PackfileRawSegment_set_integer_keyed_int': ./src/pmc/packfilerawsegment.c:72: warning: unused parameter 'pmc' ./src/pmc/packfilerawsegment.c:72: warning: unused parameter 'key' ./src/pmc/packfilerawsegment.c:72: warning: unused parameter 'value' src/pmc/packfilesegment.c ./src/pmc/packfilesegment.c: In function 'Parrot_PackfileSegment_nci_pack': ./src/pmc/packfilesegment.c:60: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_PackfileSegment_nci_unpack': ./src/pmc/packfilesegment.pmc:237: warning: unused variable 'data' ./src/pmc/packfilesegment.pmc:236: warning: unused variable 'pmc' ./src/pmc/packfilesegment.c:182: warning: unused parameter 'pmc' src/pmc/parrotrunningthread.c ./src/pmc/parrotrunningthread.c: In function 'Parrot_ParrotRunningThread_destroy': ./src/pmc/parrotrunningthread.c:58: warning: unused parameter 'interp' ./src/pmc/parrotrunningthread.c: In function 'Parrot_ParrotRunningThread_get_integer': ./src/pmc/parrotrunningthread.c:66: warning: unused parameter 'interp' ./src/pmc/parrotrunningthread.c: In function 'Parrot_ParrotRunningThread_init': ./src/pmc/parrotrunningthread.c:74: warning: unused parameter 'interp' ./src/pmc/parrotrunningthread.c: In function 'Parrot_ParrotRunningThread_nci_join': ./src/pmc/parrotrunningthread.c:104: warning: unused parameter 'pmc' ./src/pmc/parrotrunningthread.c: In function 'Parrot_ParrotRunningThread_nci_detach': ./src/pmc/parrotrunningthread.c:223: warning: unused parameter 'pmc' ./src/pmc/parrotrunningthread.c: In function 'Parrot_ParrotRunningThread_nci_kill': ./src/pmc/parrotrunningthread.c:302: warning: unused parameter 'pmc' src/pmc/pccmethod_test.c ./src/pmc/pccmethod_test.c: In function 'Parrot_PCCMETHOD_Test_nci_test_method': ./src/pmc/pccmethod_test.c:37: warning: unused parameter 'pmc' ./src/pmc/pccmethod_test.c: In function 'Parrot_PCCMETHOD_Test_nci_test_method0': ./src/pmc/pccmethod_test.c:117: warning: unused parameter 'pmc' ./src/pmc/pccmethod_test.c: In function 'Parrot_PCCMETHOD_Test_nci_test_method1': ./src/pmc/pccmethod_test.c:200: warning: unused parameter 'pmc' ./src/pmc/pccmethod_test.c: In function 'Parrot_PCCMETHOD_Test_nci_test_method2': ./src/pmc/pccmethod_test.c:293: warning: unused parameter 'pmc' ./src/pmc/pccmethod_test.c: In function 'Parrot_PCCMETHOD_Test_nci_test_method3': ./src/pmc/pccmethod_test.c:421: warning: unused parameter 'pmc' ./src/pmc/pccmethod_test.c: In function 'Parrot_PCCMETHOD_Test_nci_test_method4': ./src/pmc/pccmethod_test.c:510: warning: unused parameter 'pmc' src/pmc/pmcproxy.c ./src/pmc/pmcproxy.c: In function 'Parrot_PMCProxy_destroy': ./src/pmc/pmcproxy.c:90: warning: unused parameter 'interp' ./src/pmc/pmcproxy.c: In function 'Parrot_PMCProxy_type': ./src/pmc/pmcproxy.c:385: warning: unused parameter 'interp' ./src/pmc/pmcproxy.c: In function 'Parrot_PMCProxy_nci_name': ./src/pmc/pmcproxy.c:394: warning: unused parameter 'pmc' ./src/pmc/pmcproxy.c: In function 'Parrot_PMCProxy_nci_get_namespace': ./src/pmc/pmcproxy.c:509: warning: unused parameter 'pmc' ./src/pmc/pmcproxy.c: In function 'Parrot_PMCProxy_nci_new': ./src/pmc/pmcproxy.c:624: warning: unused parameter 'pmc' ./src/pmc/pmcproxy.c: In function 'Parrot_PMCProxy_nci_methods': ./src/pmc/pmcproxy.c:743: warning: unused parameter 'pmc' ./src/pmc/pmcproxy.c: In function 'Parrot_PMCProxy_nci_parents': ./src/pmc/pmcproxy.c:857: warning: unused parameter 'pmc' ./src/pmc/pmcproxy.c: In function 'Parrot_PMCProxy_nci_inspect': ./src/pmc/pmcproxy.c:971: warning: unused parameter 'pmc' src/pmc/resizablebooleanarray.c src/pmc/resizablefloatarray.c ./src/pmc/resizablefloatarray.c: In function 'Parrot_ResizableFloatArray_init': ./src/pmc/resizablefloatarray.c:82: warning: unused parameter 'interp' src/pmc/resizableintegerarray.c ./src/pmc/resizableintegerarray.c: In function 'Parrot_ResizableIntegerArray_init': ./src/pmc/resizableintegerarray.c:122: warning: unused parameter 'interp' src/pmc/resizablepmcarray.c ./src/pmc/resizablepmcarray.c: In function 'Parrot_ResizablePMCArray_exists_keyed_int': ./src/pmc/resizablepmcarray.c:111: warning: unused parameter 'interp' ./src/pmc/resizablepmcarray.c: In function 'Parrot_ResizablePMCArray_init': ./src/pmc/resizablepmcarray.c:174: warning: unused parameter 'interp' ./src/pmc/resizablepmcarray.c: In function 'Parrot_ResizablePMCArray_nci_append': /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm:471: warning: label 'append_returns' defined but not used ./src/pmc/resizablepmcarray.c:676: warning: unused parameter 'pmc' ./src/pmc/resizablepmcarray.c: In function 'Parrot_ResizablePMCArray_nci_shift': ./src/pmc/resizablepmcarray.c:798: warning: unused parameter 'pmc' ./src/pmc/resizablepmcarray.c: In function 'Parrot_ResizablePMCArray_nci_pop': ./src/pmc/resizablepmcarray.c:912: warning: unused parameter 'pmc' ./src/pmc/resizablepmcarray.c: In function 'Parrot_ResizablePMCArray_nci_unshift': ./src/pmc/resizablepmcarray.c:1026: warning: unused parameter 'pmc' ./src/pmc/resizablepmcarray.c: In function 'Parrot_ResizablePMCArray_nci_push': ./src/pmc/resizablepmcarray.c:1107: warning: unused parameter 'pmc' src/pmc/resizablestringarray.c ./src/pmc/resizablestringarray.c: In function 'Parrot_ResizableStringArray_init': ./src/pmc/resizablestringarray.c:120: warning: unused parameter 'interp' ./src/pmc/resizablestringarray.c: In function 'Parrot_ResizableStringArray_nci_shift': ./src/pmc/resizablestringarray.c:479: warning: unused parameter 'pmc' ./src/pmc/resizablestringarray.c: In function 'Parrot_ResizableStringArray_nci_pop': ./src/pmc/resizablestringarray.c:593: warning: unused parameter 'pmc' ./src/pmc/resizablestringarray.c: In function 'Parrot_ResizableStringArray_nci_unshift': ./src/pmc/resizablestringarray.c:707: warning: unused parameter 'pmc' ./src/pmc/resizablestringarray.c: In function 'Parrot_ResizableStringArray_nci_push': ./src/pmc/resizablestringarray.c:788: warning: unused parameter 'pmc' src/pmc/role.c ./src/pmc/role.c: In function 'Parrot_Role_destroy': ./src/pmc/role.c:275: warning: unused parameter 'interp' ./src/pmc/role.c: In function 'Parrot_Role_nci_name': ./src/pmc/role.c:497: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_get_namespace': ./src/pmc/role.c:626: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_attributes': ./src/pmc/role.c:741: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_add_attribute': ./src/pmc/role.c:855: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_methods': ./src/pmc/role.c:941: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_add_method': ./src/pmc/role.c:1055: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_remove_method': ./src/pmc/role.c:1138: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_roles': ./src/pmc/role.c:1219: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_add_role': ./src/pmc/role.c:1333: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_inspect': ./src/pmc/role.c:1442: warning: unused parameter 'pmc' ./src/pmc/role.c: In function 'Parrot_Role_nci_does': ./src/pmc/role.c:1567: warning: unused parameter 'pmc' src/pmc/scalar.c ./src/pmc/scalar.c: In function 'Parrot_scalar_defined': ./src/pmc/scalar.c:340: warning: unused parameter 'interp' ./src/pmc/scalar.c:340: warning: unused parameter 'pmc' ./src/pmc/scalar.c: In function 'Parrot_scalar_logical_and': ./src/pmc/scalar.c:786: warning: unused parameter 'dest' ./src/pmc/scalar.c: In function 'Parrot_scalar_logical_or': ./src/pmc/scalar.c:810: warning: unused parameter 'dest' ./src/pmc/scalar.c: In function 'Parrot_scalar_multi_multiply_Complex_PMC': ./src/pmc/scalar.c:1122: warning: unused parameter 'pmc' ./src/pmc/scalar.c:1122: warning: unused parameter 'value' ./src/pmc/scalar.c:1122: warning: unused parameter 'dest' ./src/pmc/scalar.c: In function 'Parrot_scalar_multi_i_multiply_Complex': ./src/pmc/scalar.c:1143: warning: unused parameter 'pmc' ./src/pmc/scalar.c:1143: warning: unused parameter 'value' ./src/pmc/scalar.c: In function 'Parrot_scalar_multi_is_equal_PMC': ./src/pmc/scalar.c:1276: warning: unused parameter 'interp' src/pmc/scheduler.c ./src/pmc/scheduler.c: In function 'Parrot_Scheduler_destroy': ./src/pmc/scheduler.c:57: warning: unused parameter 'interp' ./src/pmc/scheduler.c: In function 'Parrot_Scheduler_thawfinish': ./src/pmc/scheduler.c:256: warning: unused parameter 'info' ./src/pmc/scheduler.c: In function 'Parrot_Scheduler_nci_add_handler': ./src/pmc/scheduler.c:283: warning: unused parameter 'pmc' ./src/pmc/scheduler.c: In function 'Parrot_Scheduler_nci_delete_handler': /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm:471: warning: label 'delete_handler_returns' defined but not used ./src/pmc/scheduler.c:365: warning: unused parameter 'pmc' ./src/pmc/scheduler.c: In function 'Parrot_Scheduler_nci_find_handler': ./src/pmc/scheduler.c:499: warning: unused parameter 'pmc' ./src/pmc/scheduler.c: In function 'Parrot_Scheduler_nci_count_handlers': ./src/pmc/scheduler.c:674: warning: unused parameter 'pmc' src/pmc/schedulermessage.c ./src/pmc/schedulermessage.c: In function 'Parrot_SchedulerMessage_destroy': ./src/pmc/schedulermessage.c:45: warning: unused parameter 'interp' ./src/pmc/schedulermessage.c: In function 'Parrot_SchedulerMessage_get_integer': ./src/pmc/schedulermessage.c:69: warning: unused parameter 'interp' ./src/pmc/schedulermessage.c: In function 'Parrot_SchedulerMessage_get_string': ./src/pmc/schedulermessage.c:78: warning: unused parameter 'interp' ./src/pmc/schedulermessage.c: In function 'Parrot_SchedulerMessage_set_integer_native': ./src/pmc/schedulermessage.c:148: warning: unused parameter 'interp' ./src/pmc/schedulermessage.c: In function 'Parrot_SchedulerMessage_set_string_native': ./src/pmc/schedulermessage.c:157: warning: unused parameter 'interp' src/pmc/slice.c ./src/pmc/slice.c: In function 'Parrot_Slice_clone': ./src/pmc/slice.c:238: warning: unused parameter 'pmc' ./src/pmc/slice.c: In function 'Parrot_Slice_destroy': ./src/pmc/slice.c:247: warning: unused parameter 'interp' ./src/pmc/slice.c: In function 'Parrot_Slice_elements': ./src/pmc/slice.c:265: warning: unused parameter 'interp' ./src/pmc/slice.c: In function 'Parrot_Slice_get_integer_keyed': ./src/pmc/slice.c:291: warning: unused parameter 'interp' ./src/pmc/slice.c:291: warning: unused parameter 'pmc' ./src/pmc/slice.c: In function 'Parrot_Slice_get_pmc_keyed': ./src/pmc/slice.c:310: warning: unused parameter 'interp' ./src/pmc/slice.c: In function 'Parrot_Slice_get_string': ./src/pmc/slice.c:322: warning: unused parameter 'interp' ./src/pmc/slice.c: In function 'Parrot_Slice_get_string_keyed': ./src/pmc/slice.c:332: warning: unused parameter 'pmc' ./src/pmc/slice.c: In function 'Parrot_Slice_init': ./src/pmc/slice.c:341: warning: unused parameter 'interp' src/pmc/stringhandle.c ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_destroy': ./src/pmc/stringhandle.c:64: warning: unused parameter 'interp' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_init': ./src/pmc/stringhandle.c:89: warning: unused parameter 'interp' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_open': ./src/pmc/stringhandle.c:125: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_StringHandle_nci_is_tty': ./src/pmc/stringhandle.pmc:335: warning: unused variable 'pmc' ./src/pmc/stringhandle.c:282: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_close': ./src/pmc/stringhandle.c:395: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_is_closed': ./src/pmc/stringhandle.c:509: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_read': ./src/pmc/stringhandle.c:650: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_readline': ./src/pmc/stringhandle.c:791: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_StringHandle_nci_readall': ./src/pmc/stringhandle.pmc:983: warning: unused variable 'got_name' ./src/pmc/stringhandle.pmc:982: warning: unused variable 'name' ./src/pmc/stringhandle.c:926: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_flush': ./src/pmc/stringhandle.c:1059: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_print': ./src/pmc/stringhandle.c:1138: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_puts': ./src/pmc/stringhandle.c:1221: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_buffer_type': ./src/pmc/stringhandle.c:1354: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_StringHandle_nci_buffer_size': ./src/pmc/stringhandle.pmc:1600: warning: unused variable 'got_size' ./src/pmc/stringhandle.pmc:1599: warning: unused variable 'new_size' ./src/pmc/stringhandle.c:1543: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_mode': ./src/pmc/stringhandle.c:1692: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_encoding': ./src/pmc/stringhandle.c:1811: warning: unused parameter 'pmc' ./src/pmc/stringhandle.c: In function 'Parrot_StringHandle_nci_eof': ./src/pmc/stringhandle.c:1965: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_StringHandle_nci_get_fd': ./src/pmc/stringhandle.pmc:2161: warning: unused variable 'pmc' ./src/pmc/stringhandle.c:2108: warning: unused parameter 'pmc' src/pmc/task.c ./src/pmc/task.c: In function 'Parrot_Task_destroy': ./src/pmc/task.c:65: warning: unused parameter 'interp' ./src/pmc/task.c: In function 'Parrot_Task_get_integer': ./src/pmc/task.c:139: warning: unused parameter 'interp' ./src/pmc/task.c: In function 'Parrot_Task_set_integer_native': ./src/pmc/task.c:286: warning: unused parameter 'interp' ./src/pmc/task.c: In function 'Parrot_Task_set_number_native': ./src/pmc/task.c:295: warning: unused parameter 'interp' ./src/pmc/task.c: In function 'Parrot_Task_set_string_native': ./src/pmc/task.c:304: warning: unused parameter 'interp' ./src/pmc/task.c: In function 'Parrot_Task_thawfinish': ./src/pmc/task.c:384: warning: unused parameter 'interp' ./src/pmc/task.c:384: warning: unused parameter 'info' src/pmc/undef.c ./src/pmc/undef.c: In function 'Parrot_Undef_defined': ./src/pmc/undef.c:71: warning: unused parameter 'interp' ./src/pmc/undef.c:71: warning: unused parameter 'pmc' ./src/pmc/undef.c: In function 'Parrot_Undef_get_bool': ./src/pmc/undef.c:79: warning: unused parameter 'interp' ./src/pmc/undef.c:79: warning: unused parameter 'pmc' ./src/pmc/undef.c: In function 'Parrot_Undef_get_integer': ./src/pmc/undef.c:87: warning: unused parameter 'interp' ./src/pmc/undef.c:87: warning: unused parameter 'pmc' ./src/pmc/undef.c: In function 'Parrot_Undef_get_number': ./src/pmc/undef.c:95: warning: unused parameter 'interp' ./src/pmc/undef.c:95: warning: unused parameter 'pmc' ./src/pmc/undef.c: In function 'Parrot_Undef_get_string': ./src/pmc/undef.c:103: warning: unused parameter 'pmc' ./src/pmc/undef.c: In function 'Parrot_Undef_share': ./src/pmc/undef.c:150: warning: unused parameter 'interp' ./src/pmc/undef.c:150: warning: unused parameter 'pmc' ./src/pmc/undef.c: In function 'Parrot_Undef_multi_is_equal_Undef': ./src/pmc/undef.c:169: warning: unused parameter 'interp' ./src/pmc/undef.c:169: warning: unused parameter 'pmc' ./src/pmc/undef.c:169: warning: unused parameter 'value' ./src/pmc/undef.c: In function 'Parrot_Undef_multi_is_equal_DEFAULT': ./src/pmc/undef.c:177: warning: unused parameter 'interp' ./src/pmc/undef.c:177: warning: unused parameter 'pmc' ./src/pmc/undef.c:177: warning: unused parameter 'value' src/string/encoding/fixed_8.c src/string/encoding/fixed_8.c: In function 'get_byte': src/string/encoding/fixed_8.c:291: warning: unused parameter 'interp' src/string/encoding/ucs2.c src/string/encoding/ucs2.c: In function 'get_codepoint': src/string/encoding/ucs2.c:251: warning: unused parameter 'interp' src/string/encoding/ucs2.c: In function 'set_codepoint': src/string/encoding/ucs2.c:274: warning: unused parameter 'interp' src/string/encoding/ucs2.c: In function 'get_byte': src/string/encoding/ucs2.c:298: warning: unused parameter 'offset' src/string/encoding/ucs2.c: In function 'set_byte': src/string/encoding/ucs2.c:315: warning: unused parameter 'offset' src/string/encoding/ucs2.c:315: warning: unused parameter 'byte' src/string/encoding/ucs2.c: In function 'get_bytes': src/string/encoding/ucs2.c:373: warning: unused parameter 'offset' src/string/encoding/ucs2.c:373: warning: unused parameter 'count' src/string/encoding/ucs2.c: In function 'get_codepoints_inplace': src/string/encoding/ucs2.c:395: warning: unused parameter 'offset' src/string/encoding/ucs2.c:395: warning: unused parameter 'count' src/string/encoding/ucs2.c: In function 'get_bytes_inplace': src/string/encoding/ucs2.c:416: warning: unused parameter 'offset' src/string/encoding/ucs2.c:416: warning: unused parameter 'count' src/string/encoding/ucs2.c: In function 'set_codepoints': src/string/encoding/ucs2.c:435: warning: unused parameter 'offset' src/string/encoding/ucs2.c:435: warning: unused parameter 'count' src/string/encoding/ucs2.c: In function 'set_bytes': src/string/encoding/ucs2.c:454: warning: unused parameter 'offset' src/string/encoding/ucs2.c:454: warning: unused parameter 'count' src/string/encoding/ucs2.c: In function 'codepoints': src/string/encoding/ucs2.c:490: warning: unused parameter 'interp' src/string/encoding/ucs2.c: In function 'bytes': src/string/encoding/ucs2.c:513: warning: unused parameter 'interp' src/string/encoding/ucs2.c: In function 'ucs2_decode_and_advance': src/string/encoding/ucs2.c:531: warning: unused parameter 'interp' src/string/encoding/ucs2.c: In function 'ucs2_encode_and_advance': src/string/encoding/ucs2.c:558: warning: unused parameter 'interp' src/string/encoding/ucs2.c: In function 'iter_init': src/string/encoding/ucs2.c:599: warning: unused parameter 'interp' src/string/encoding/utf16.c src/string/encoding/utf16.c: In function 'get_codepoint': src/string/encoding/utf16.c:350: warning: unused parameter 'interp' src/string/encoding/utf16.c: In function 'utf16_decode_and_advance': src/string/encoding/utf16.c:674: warning: unused parameter 'interp' src/string/encoding/utf16.c: In function 'utf16_encode_and_advance': src/string/encoding/utf16.c:701: warning: unused parameter 'interp' src/string/encoding/utf16.c: In function 'utf16_set_position': src/string/encoding/utf16.c:723: warning: unused parameter 'interp' src/string/encoding/utf16.c: In function 'iter_init': src/string/encoding/utf16.c:747: warning: unused parameter 'interp' src/string/encoding/utf8.c src/string/encoding/utf8.c: In function 'get_bytes_inplace': src/string/encoding/utf8.c:846: warning: unused parameter 'offset' src/string/encoding/utf8.c:846: warning: unused parameter 'count' src/string/encoding/utf8.c: In function 'set_codepoints': src/string/encoding/utf8.c:865: warning: unused parameter 'offset' src/string/encoding/utf8.c:865: warning: unused parameter 'count' src/string/encoding/utf8.c: In function 'set_bytes': src/string/encoding/utf8.c:884: warning: unused parameter 'offset' src/string/encoding/utf8.c:884: warning: unused parameter 'count' src/string/encoding/utf8.c: At top level: src/string/encoding/utf8.c:279: warning: 'utf8_characters' defined but not used src/string/encoding/utf8.c:416: warning: 'utf8_skip_backward' defined but not used compilers/imcc/imcparser.c compilers/imcc/imcc.y: In function 'add_pcc_named_arg_var': compilers/imcc/imcc.y:739: warning: unused parameter 'interp' compilers/imcc/imcparser.c: In function 'yyparse': compilers/imcc/imcparser.c:2843: warning: statement with no effect compilers/imcc/imcparser.c:4951: warning: logical '&&' with non-zero constant will always evaluate as true compilers/imcc/imcparser.c:4954: warning: statement with no effect compilers/imcc/imcparser.c:5111: warning: statement with no effect compilers/imcc/imcparser.c:5115: warning: statement with no effect compilers/imcc/imclexer.c compilers/imcc/imclexer.c:823: warning: size of 'yy_nxt' is 14078 bytes compilers/imcc/imclexer.c:1601: warning: size of 'yy_chk' is 14078 bytes compilers/imcc/imclexer.c: In function 'yy_get_next_buffer': compilers/imcc/imclexer.c:4177: warning: comparison between signed and unsigned compilers/imcc/imclexer.c: In function 'yy_fatal_error': compilers/imcc/imclexer.c:4796: warning: unused parameter 'yyscanner' compilers/imcc/imclexer.c: In function 'yyalloc': compilers/imcc/imclexer.c:5116: warning: unused parameter 'yyscanner' compilers/imcc/imclexer.c: In function 'yyrealloc': compilers/imcc/imclexer.c:5121: warning: unused parameter 'yyscanner' compilers/imcc/imclexer.c: In function 'yyfree': compilers/imcc/imclexer.c:5133: warning: unused parameter 'yyscanner' compilers/imcc/imcc.l: In function 'read_macro': compilers/imcc/imcc.l:1001: warning: unused variable 'old_s' compilers/imcc/imcc.l: At top level: compilers/imcc/imclexer.c:4787: warning: 'yy_top_state' defined but not used compilers/imcc/imc.c compilers/imcc/main.c compilers/imcc/symreg.c compilers/imcc/instructions.c compilers/imcc/cfg.c compilers/imcc/reg_alloc.c compilers/imcc/sets.c compilers/imcc/debug.c compilers/imcc/optimizer.c compilers/imcc/pbc.c compilers/imcc/parser_util.c compilers/imcc/pcc.c /usr/bin/perl -MExtUtils::Command -e mkpath blib/lib ar cr blib/lib/libparrot.a src/string/api.o src/ops/core_ops.o src/ops/core_ops_switch.o src/byteorder.o src/string/charset.o src/core_pmcs.o src/datatypes.o src/debug.o src/dynext.o src/embed.o src/string/encoding.o src/events.o src/exceptions.o src/exit.o src/extend.o src/extend_vtable.o src/gc/api.o src/gc/generational_ms.o src/gc/incremental_ms.o src/gc/memory.o src/gc/pools.o src/gc/register.o src/gc/mark_sweep.o src/gc/system.o src/global.o src/global_setup.o src/hash.o src/hll.o src/call/pcc.o src/inter_cb.o src/inter_create.o src/inter_misc.o src/interpreter.o src/call/ops.o src/key.o src/library.o src/list.o src/longopt.o src/misc.o src/multidispatch.o src/nci.o src/oo.o src/packfile.o src/packout.o src/pic_jit.o src/pic.o src/platform.o src/pmc_freeze.o src/pmc.o src/runops_cores.o src/scheduler.o src/spf_render.o src/spf_vtable.o src/stacks.o src/string/primitives.o src/sub.o src/thread.o src/trace.o src/tsq.o src/utils.o src/vtables.o src/warnings.o src/packfile/pf_items.o src/asmfun.o src/ops/core_ops_cg.o src/ops/core_ops_cgp.o src/exec.o src/exec_cpu.o src/exec_dep.o src/exec_save.o src/jit.o src/jit_cpu.o src/jit_debug.o src/jit_debug_xcoff.o src/jit_defs.o src/gc/resources.o src/string/charset/ascii.o src/string/charset/binary.o src/string/charset/iso-8859-1.o src/string/charset/tables.o src/string/charset/unicode.o src/io/core.o src/io/api.o src/io/utf8.o src/io/buffer.o src/io/unix.o src/io/win32.o src/io/portable.o src/io/filehandle.o src/pmc/default.o src/pmc/null.o src/pmc/env.o src/pmc/key.o src/pmc/random.o src/pmc/unmanagedstruct.o src/pmc/managedstruct.o src/pmc/exception.o src/pmc/parrotlibrary.o src/pmc/parrotinterpreter.o src/pmc/parrotthread.o src/pmc/lexpad.o src/pmc/timer.o src/pmc/pointer.o src/pmc/sub.o src/pmc/continuation.o src/pmc/retcontinuation.o src/pmc/coroutine.o src/pmc/eval.o src/pmc/nci.o src/pmc/float.o src/pmc/integer.o src/pmc/bigint.o src/pmc/bignum.o src/pmc/complex.o src/pmc/string.o src/pmc/boolean.o src/pmc/ref.o src/pmc/sharedref.o src/pmc/array.o src/pmc/fixedintegerarray.o src/pmc/iterator.o src/pmc/fixedstringarray.o src/pmc/hash.o src/pmc/orderedhash.o src/pmc/os.o src/pmc/file.o src/pmc/addrregistry.o src/pmc/bound_nci.o src/pmc/callsignature.o src/pmc/capture.o src/pmc/class.o src/pmc/codestring.o src/pmc/cpointer.o src/pmc/eventhandler.o src/pmc/exceptionhandler.o src/pmc/exporter.o src/pmc/filehandle.o src/pmc/fixedbooleanarray.o src/pmc/fixedfloatarray.o src/pmc/fixedpmcarray.o src/pmc/lexinfo.o src/pmc/multisub.o src/pmc/namespace.o src/pmc/object.o src/pmc/packfile.o src/pmc/packfileannotation.o src/pmc/packfileannotationkeys.o src/pmc/packfileannotations.o src/pmc/packfileconstanttable.o src/pmc/packfiledirectory.o src/pmc/packfilefixupentry.o src/pmc/packfilefixuptable.o src/pmc/packfilerawsegment.o src/pmc/packfilesegment.o src/pmc/parrotrunningthread.o src/pmc/pccmethod_test.o src/pmc/pmcproxy.o src/pmc/resizablebooleanarray.o src/pmc/resizablefloatarray.o src/pmc/resizableintegerarray.o src/pmc/resizablepmcarray.o src/pmc/resizablestringarray.o src/pmc/role.o src/pmc/scalar.o src/pmc/scheduler.o src/pmc/schedulermessage.o src/pmc/slice.o src/pmc/stringhandle.o src/pmc/task.o src/pmc/undef.o src/string/encoding/fixed_8.o src/string/encoding/ucs2.o src/string/encoding/utf16.o src/string/encoding/utf8.o compilers/imcc/imcparser.o compilers/imcc/imclexer.o compilers/imcc/imc.o compilers/imcc/main.o compilers/imcc/symreg.o compilers/imcc/instructions.o compilers/imcc/cfg.o compilers/imcc/reg_alloc.o compilers/imcc/sets.o compilers/imcc/debug.o compilers/imcc/optimizer.o compilers/imcc/pbc.o compilers/imcc/parser_util.o compilers/imcc/pcc.o : blib/lib/libparrot.a /usr/bin/perl -MExtUtils::Command -e mkpath blib/lib gcc -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/usr/local/lib -o blib/lib/libparrot.so.1.0.0 -Wl,-soname=libparrot.so.1.0.0 \ src/string/api.o src/ops/core_ops.o src/ops/core_ops_switch.o src/byteorder.o src/string/charset.o src/core_pmcs.o src/datatypes.o src/debug.o src/dynext.o src/embed.o src/string/encoding.o src/events.o src/exceptions.o src/exit.o src/extend.o src/extend_vtable.o src/gc/api.o src/gc/generational_ms.o src/gc/incremental_ms.o src/gc/memory.o src/gc/pools.o src/gc/register.o src/gc/mark_sweep.o src/gc/system.o src/global.o src/global_setup.o src/hash.o src/hll.o src/call/pcc.o src/inter_cb.o src/inter_create.o src/inter_misc.o src/interpreter.o src/call/ops.o src/key.o src/library.o src/list.o src/longopt.o src/misc.o src/multidispatch.o src/nci.o src/oo.o src/packfile.o src/packout.o src/pic_jit.o src/pic.o src/platform.o src/pmc_freeze.o src/pmc.o src/runops_cores.o src/scheduler.o src/spf_render.o src/spf_vtable.o src/stacks.o src/string/primitives.o src/sub.o src/thread.o src/trace.o src/tsq.o src/utils.o src/vtables.o src/warnings.o src/packfile/pf_items.o src/asmfun.o src/ops/core_ops_cg.o src/ops/core_ops_cgp.o src/exec.o src/exec_cpu.o src/exec_dep.o src/exec_save.o src/jit.o src/jit_cpu.o src/jit_debug.o src/jit_debug_xcoff.o src/jit_defs.o src/gc/resources.o src/string/charset/ascii.o src/string/charset/binary.o src/string/charset/iso-8859-1.o src/string/charset/tables.o src/string/charset/unicode.o src/io/core.o src/io/api.o src/io/utf8.o src/io/buffer.o src/io/unix.o src/io/win32.o src/io/portable.o src/io/filehandle.o src/pmc/default.o src/pmc/null.o src/pmc/env.o src/pmc/key.o src/pmc/random.o src/pmc/unmanagedstruct.o src/pmc/managedstruct.o src/pmc/exception.o src/pmc/parrotlibrary.o src/pmc/parrotinterpreter.o src/pmc/parrotthread.o src/pmc/lexpad.o src/pmc/timer.o src/pmc/pointer.o src/pmc/sub.o src/pmc/continuation.o src/pmc/retcontinuation.o src/pmc/coroutine.o src/pmc/eval.o src/pmc/nci.o src/pmc/float.o src/pmc/integer.o src/pmc/bigint.o src/pmc/bignum.o src/pmc/complex.o src/pmc/string.o src/pmc/boolean.o src/pmc/ref.o src/pmc/sharedref.o src/pmc/array.o src/pmc/fixedintegerarray.o src/pmc/iterator.o src/pmc/fixedstringarray.o src/pmc/hash.o src/pmc/orderedhash.o src/pmc/os.o src/pmc/file.o src/pmc/addrregistry.o src/pmc/bound_nci.o src/pmc/callsignature.o src/pmc/capture.o src/pmc/class.o src/pmc/codestring.o src/pmc/cpointer.o src/pmc/eventhandler.o src/pmc/exceptionhandler.o src/pmc/exporter.o src/pmc/filehandle.o src/pmc/fixedbooleanarray.o src/pmc/fixedfloatarray.o src/pmc/fixedpmcarray.o src/pmc/lexinfo.o src/pmc/multisub.o src/pmc/namespace.o src/pmc/object.o src/pmc/packfile.o src/pmc/packfileannotation.o src/pmc/packfileannotationkeys.o src/pmc/packfileannotations.o src/pmc/packfileconstanttable.o src/pmc/packfiledirectory.o src/pmc/packfilefixupentry.o src/pmc/packfilefixuptable.o src/pmc/packfilerawsegment.o src/pmc/packfilesegment.o src/pmc/parrotrunningthread.o src/pmc/pccmethod_test.o src/pmc/pmcproxy.o src/pmc/resizablebooleanarray.o src/pmc/resizablefloatarray.o src/pmc/resizableintegerarray.o src/pmc/resizablepmcarray.o src/pmc/resizablestringarray.o src/pmc/role.o src/pmc/scalar.o src/pmc/scheduler.o src/pmc/schedulermessage.o src/pmc/slice.o src/pmc/stringhandle.o src/pmc/task.o src/pmc/undef.o src/string/encoding/fixed_8.o src/string/encoding/ucs2.o src/string/encoding/utf16.o src/string/encoding/utf8.o compilers/imcc/imcparser.o compilers/imcc/imclexer.o compilers/imcc/imc.o compilers/imcc/main.o compilers/imcc/symreg.o compilers/imcc/instructions.o compilers/imcc/cfg.o compilers/imcc/reg_alloc.o compilers/imcc/sets.o compilers/imcc/debug.o compilers/imcc/optimizer.o compilers/imcc/pbc.o compilers/imcc/parser_util.o compilers/imcc/pcc.o -lcurses -lm -lgmp -lreadline -licuuc -licudata -lpthread -lm ( cd blib/lib ; ln -sf libparrot.so.1.0.0 libparrot.so ) src/main.c /usr/bin/perl tools/build/parrot_config_c.pl --mini > \ src/null_config.c src/null_config.c gcc -o miniparrot src/main.o src/null_config.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E Invoking Parrot to generate runtime/parrot/include/config.fpmc --cross your fingers ./miniparrot config_lib.pasm > runtime/parrot/include/config.fpmc /usr/bin/perl tools/build/parrot_config_c.pl > \ src/parrot_config.c src/parrot_config.c src/parrot_config.c:22: warning: size of 'parrot_config' is 22236 bytes gcc -o parrot \ src/main.o src/parrot_config.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E -Wl,-E -Wl,-rpath,/usr/lib/perl5/5.10.0/ppc-linux-thread-multi/CORE ./parrot -o runtime/parrot/include/parrotlib.pbc runtime/parrot/library/parrotlib.pir gmake -C docs gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/docs' /usr/bin/perl -MExtUtils::Command -e mkpath ops /usr/bin/perldoc -ud packfile-c.pod ../src/packfile.c Perldoc (Pod::Perldoc::ToPod) output saved to packfile-c.pod /usr/bin/perldoc -ud ops/bit.pod ../src/ops/bit.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/bit.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/bit.pod /usr/bin/perldoc -ud ops/cmp.pod ../src/ops/cmp.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/cmp.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/cmp.pod /usr/bin/perldoc -ud ops/core.pod ../src/ops/core.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/core.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/core.pod /usr/bin/perldoc -ud ops/debug.pod ../src/ops/debug.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/debug.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/debug.pod /usr/bin/perldoc -ud ops/experimental.pod ../src/ops/experimental.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/experimental.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/experimental.pod /usr/bin/perldoc -ud ops/io.pod ../src/ops/io.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/io.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/io.pod /usr/bin/perldoc -ud ops/math.pod ../src/ops/math.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/math.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/math.pod /usr/bin/perldoc -ud ops/object.pod ../src/ops/object.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/object.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/object.pod /usr/bin/perldoc -ud ops/obscure.pod ../src/ops/obscure.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/obscure.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/obscure.pod /usr/bin/perldoc -ud ops/pic.pod ../src/ops/pic.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/pic.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/pic.pod /usr/bin/perldoc -ud ops/pmc.pod ../src/ops/pmc.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/pmc.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/pmc.pod /usr/bin/perldoc -ud ops/set.pod ../src/ops/set.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/set.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/set.pod /usr/bin/perldoc -ud ops/string.pod ../src/ops/string.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/string.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/string.pod /usr/bin/perldoc -ud ops/sys.pod ../src/ops/sys.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/sys.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/sys.pod /usr/bin/perldoc -ud ops/var.pod ../src/ops/var.ops Perldoc (Pod::Perldoc::ToPod) output saved to ops/var.pod /usr/bin/perl -MExtUtils::Command -e ExtUtils::Command::chmod 0644 ops/var.pod gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/docs' src/nci_test.c gcc -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/usr/local/lib \ -o runtime/parrot/dynext/libnci_test.so src/nci_test.o -lcurses -lm -lgmp -lreadline ./parrot -o runtime/parrot/library/CGI/QueryHash.pbc runtime/parrot/library/CGI/QueryHash.pir ./parrot -o runtime/parrot/library/Crow.pbc runtime/parrot/library/Crow.pir ./parrot -o runtime/parrot/library/config.pbc runtime/parrot/library/config.pir ./parrot -o runtime/parrot/library/Config/JSON.pbc runtime/parrot/library/Config/JSON.pir ./parrot -o runtime/parrot/library/Data/Dumper/Base.pbc runtime/parrot/library/Data/Dumper/Base.pir ./parrot -o runtime/parrot/library/Data/Dumper/Default.pbc runtime/parrot/library/Data/Dumper/Default.pir ./parrot -o runtime/parrot/library/Data/Dumper.pbc runtime/parrot/library/Data/Dumper.pir ./parrot -o runtime/parrot/library/Digest/MD5.pbc runtime/parrot/library/Digest/MD5.pir ./parrot -o runtime/parrot/library/dumper.pbc runtime/parrot/library/dumper.pir ./parrot -o runtime/parrot/library/yaml_dumper.pbc runtime/parrot/library/yaml_dumper.pir ./parrot -o runtime/parrot/library/Getopt/Obj.pbc runtime/parrot/library/Getopt/Obj.pir ./parrot -o runtime/parrot/library/JSON.pbc runtime/parrot/library/JSON.pir ./parrot -o runtime/parrot/library/Math/Random/mt19937ar.pbc runtime/parrot/library/Math/Random/mt19937ar.pir ./parrot -o runtime/parrot/library/Math/Rand.pbc runtime/parrot/library/Math/Rand.pir ./parrot -o runtime/parrot/library/MIME/Base64.pbc runtime/parrot/library/MIME/Base64.pir ./parrot -o runtime/parrot/library/NCI/call_toolkit_init.pbc runtime/parrot/library/NCI/call_toolkit_init.pir ./parrot -o runtime/parrot/library/ncurses.pbc runtime/parrot/library/ncurses.pir ./parrot -o runtime/parrot/library/P6object.pbc runtime/parrot/library/P6object.pir ./parrot -o runtime/parrot/library/parrotlib.pbc runtime/parrot/library/parrotlib.pir ./parrot -o runtime/parrot/library/pcre.pbc runtime/parrot/library/pcre.pir ./parrot -o runtime/parrot/library/Parrot/Coroutine.pbc runtime/parrot/library/Parrot/Coroutine.pir ./parrot -o runtime/parrot/library/Parrot/Exception.pbc runtime/parrot/library/Parrot/Exception.pir ./parrot -o runtime/parrot/library/PGE/Dumper.pbc runtime/parrot/library/PGE/Dumper.pir ./parrot -o runtime/parrot/library/PGE/Glob.pbc runtime/parrot/library/PGE/Glob.pir ./parrot -o runtime/parrot/library/PGE/Perl6Grammar.pbc runtime/parrot/library/PGE/Perl6Grammar.pir ./parrot -o runtime/parrot/library/PGE/Text.pbc runtime/parrot/library/PGE/Text.pir ./parrot -o runtime/parrot/library/PGE/Util.pbc runtime/parrot/library/PGE/Util.pir ./parrot -o runtime/parrot/library/Protoobject.pbc runtime/parrot/library/Protoobject.pir ./parrot -o runtime/parrot/library/Stream/Base.pbc runtime/parrot/library/Stream/Base.pir ./parrot -o runtime/parrot/library/Stream/Combiner.pbc runtime/parrot/library/Stream/Combiner.pir ./parrot -o runtime/parrot/library/Stream/Coroutine.pbc runtime/parrot/library/Stream/Coroutine.pir ./parrot -o runtime/parrot/library/Stream/Filter.pbc runtime/parrot/library/Stream/Filter.pir ./parrot -o runtime/parrot/library/Stream/Lines.pbc runtime/parrot/library/Stream/Lines.pir ./parrot -o runtime/parrot/library/Stream/ParrotIO.pbc runtime/parrot/library/Stream/ParrotIO.pir ./parrot -o runtime/parrot/library/Stream/Replay.pbc runtime/parrot/library/Stream/Replay.pir ./parrot -o runtime/parrot/library/Stream/Sub.pbc runtime/parrot/library/Stream/Sub.pir ./parrot -o runtime/parrot/library/Stream/Writer.pbc runtime/parrot/library/Stream/Writer.pir ./parrot -o runtime/parrot/library/String/Utils.pbc runtime/parrot/library/String/Utils.pir ./parrot -o runtime/parrot/library/Test/Builder/Output.pbc runtime/parrot/library/Test/Builder/Output.pir ./parrot -o runtime/parrot/library/Test/Builder/Test.pbc runtime/parrot/library/Test/Builder/Test.pir ./parrot -o runtime/parrot/library/Test/Builder/Tester.pbc runtime/parrot/library/Test/Builder/Tester.pir ./parrot -o runtime/parrot/library/Test/Builder/TestPlan.pbc runtime/parrot/library/Test/Builder/TestPlan.pir ./parrot -o runtime/parrot/library/Test/Builder.pbc runtime/parrot/library/Test/Builder.pir ./parrot -o runtime/parrot/library/Test/Class.pbc runtime/parrot/library/Test/Class.pir ./parrot -o runtime/parrot/library/Test/More.pbc runtime/parrot/library/Test/More.pir ./parrot -o runtime/parrot/library/Tcl/Glob.pbc runtime/parrot/library/Tcl/Glob.pir ./parrot -o runtime/parrot/library/uuid.pbc runtime/parrot/library/uuid.pir ./parrot -o runtime/parrot/library/YAML/Parser/Syck.pbc runtime/parrot/library/YAML/Parser/Syck.pir ./parrot -o runtime/parrot/library/libpcre.pbc runtime/parrot/library/libpcre.pir ./parrot -o runtime/parrot/library/Data/Replace.pbc runtime/parrot/library/Data/Replace.pir ./parrot -o runtime/parrot/library/postgres.pbc runtime/parrot/library/postgres.pir gmake -C src/dynpmc gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/src/dynpmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump dynlexpad.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c dynlexpad.pmc gcc -c -o dynlexpad.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO dynlexpad.c ./dynlexpad.c: In function 'Parrot_DynLexPad_init': ./dynlexpad.c:116: warning: unused parameter 'pmc' gcc -o dynlexpad.so dynlexpad.o -Wl,-L /builddir/build/BUILD/parrot-1.0.0/blib/lib -L/usr/local/lib -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump foo.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c foo.pmc gcc -c -o foo.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO foo.c ./foo.c: In function 'Parrot_Foo_get_integer': ./foo.c:36: warning: unused parameter 'interp' ./foo.c:36: warning: unused parameter 'pmc' ./foo.c: In function 'Parrot_Foo_multi_subtract_Integer_PMC': ./foo.c:44: warning: unused parameter 'value' ./foo.c: In function 'Parrot_Foo_multi_subtract_DEFAULT_PMC': ./foo.c:55: warning: unused parameter 'value' gcc -o foo.so foo.o -Wl,-L /builddir/build/BUILD/parrot-1.0.0/blib/lib -L/usr/local/lib -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump pair.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c pair.pmc gcc -c -o pair.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO pair.c ./pair.c: In function 'Parrot_Pair_assign_pmc': ./pair.c:50: warning: unused parameter 'interp' ./pair.c: In function 'Parrot_Pair_get_pmc_keyed': ./pair.c:71: warning: unused parameter 'interp' ./pair.c:71: warning: unused parameter 'key' ./pair.c: In function 'Parrot_Pair_get_pmc_keyed_str': ./pair.c:81: warning: unused parameter 'interp' ./pair.c:81: warning: unused parameter 'key' ./pair.c: In function 'Parrot_Pair_init': ./pair.c:91: warning: unused parameter 'interp' ./pair.c: In function 'Parrot_Pair_instantiate': ./pair.c:100: warning: unused parameter 'interp' ./pair.c:100: warning: unused parameter 'pmc' ./pair.c:100: warning: unused parameter 'sig' ./pair.c: In function 'Parrot_Pair_visit': ./pair.pmc:237: warning: unused variable 'io' ./pair.c: In function 'Parrot_Pair_nci_key': ./pair.c:264: warning: unused parameter 'pmc' ./pair.c: In function 'Parrot_Pair_nci_value': ./pair.c:380: warning: unused parameter 'pmc' ./pair.c: In function 'Parrot_Pair_nci_kv': ./pair.c:495: warning: unused parameter 'pmc' gcc -o pair.so pair.o -Wl,-L /builddir/build/BUILD/parrot-1.0.0/blib/lib -L/usr/local/lib -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump rotest.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c rotest.pmc gcc -c -o rotest.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO rotest.c ./rotest.c: In function 'Parrot_ROTest_get_integer': ./rotest.c:37: warning: unused parameter 'interp' ./rotest.c:37: warning: unused parameter 'pmc' ./rotest.c: In function 'Parrot_ROTest_set_integer_native': ./rotest.c:45: warning: unused parameter 'interp' ./rotest.c:45: warning: unused parameter 'pmc' ./rotest.c:45: warning: unused parameter 'value' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_ROTest_nci_reader': ./rotest.pmc:105: warning: unused variable 'pmc' ./rotest.c:52: warning: unused parameter 'pmc' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_ROTest_nci_writer': ./rotest.pmc:219: warning: unused variable 'pmc' ./rotest.c:165: warning: unused parameter 'pmc' gcc -o rotest.so rotest.o -Wl,-L /builddir/build/BUILD/parrot-1.0.0/blib/lib -L/usr/local/lib -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump gdbmhash.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c gdbmhash.pmc gcc -c -o gdbmhash.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO gdbmhash.c ./gdbmhash.c: In function 'Parrot_GDBMHash_destroy': ./gdbmhash.c:121: warning: unused parameter 'interp' ./gdbmhash.c: In function 'Parrot_GDBMHash_get_bool': ./gdbmhash.c:150: warning: unused parameter 'interp' ./gdbmhash.c: In function 'Parrot_GDBMHash_get_integer': ./gdbmhash.c:170: warning: unused parameter 'interp' ./gdbmhash.c: In function 'Parrot_GDBMHash_get_pointer': ./gdbmhash.c:205: warning: unused parameter 'interp' ./gdbmhash.c: In function 'Parrot_GDBMHash_init': ./gdbmhash.c:240: warning: unused parameter 'interp' ./gdbmhash.c: In function 'Parrot_GDBMHash_set_pointer': ./gdbmhash.c:288: warning: unused parameter 'interp' ./gdbmhash.pmc: In function 'Parrot_GDBMHash_get_string_keyed': ./gdbmhash.pmc:238: warning: function call has aggregate value ./gdbmhash.pmc: In function 'Parrot_GDBMHash_get_bool': ./gdbmhash.pmc:176: warning: function call has aggregate value ./gdbmhash.pmc: In function 'Parrot_GDBMHash_get_integer': ./gdbmhash.pmc:150: warning: function call has aggregate value ./gdbmhash.pmc:152: warning: function call has aggregate value gcc -o gdbmhash.so gdbmhash.o -Wl,-L /builddir/build/BUILD/parrot-1.0.0/blib/lib -L/usr/local/lib -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -lgdbm /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump rational.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c rational.pmc gcc -c -o rational.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO rational.c ./rational.c: In function 'Parrot_Rational_decrement': ./rational.c:350: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_destroy': ./rational.c:363: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_get_bool': ./rational.c:395: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_get_number': ./rational.c:434: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_i_absolute': ./rational.c:471: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_i_neg': ./rational.c:531: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_increment': ./rational.c:559: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_init': ./rational.c:572: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_set_integer_native': ./rational.c:623: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_set_number_native': ./rational.c:636: warning: unused parameter 'interp' /builddir/build/BUILD/parrot-1.0.0/tools/build/../../lib/Parrot/Pmc2c/PCCMETHOD.pm: In function 'Parrot_Rational_nci_version': ./rational.pmc:750: warning: unused variable 'pmc' ./rational.c:697: warning: unused parameter 'pmc' ./rational.c: In function 'Parrot_Rational_multi_add_DEFAULT_PMC': ./rational.c:852: warning: unused parameter 'pmc' ./rational.c:852: warning: unused parameter 'value' ./rational.c:852: warning: unused parameter 'dest' ./rational.c: In function 'Parrot_Rational_multi_i_add_Rational': ./rational.c:877: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_multi_i_add_DEFAULT': ./rational.c:889: warning: unused parameter 'pmc' ./rational.c:889: warning: unused parameter 'value' ./rational.c: In function 'Parrot_Rational_multi_subtract_DEFAULT_PMC': ./rational.c:934: warning: unused parameter 'pmc' ./rational.c:934: warning: unused parameter 'value' ./rational.c:934: warning: unused parameter 'dest' ./rational.c: In function 'Parrot_Rational_multi_i_subtract_Rational': ./rational.c:959: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_multi_i_subtract_DEFAULT': ./rational.c:971: warning: unused parameter 'pmc' ./rational.c:971: warning: unused parameter 'value' ./rational.c: In function 'Parrot_Rational_multi_multiply_DEFAULT_PMC': ./rational.c:1016: warning: unused parameter 'pmc' ./rational.c:1016: warning: unused parameter 'value' ./rational.c:1016: warning: unused parameter 'dest' ./rational.c: In function 'Parrot_Rational_multi_i_multiply_Rational': ./rational.c:1041: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_multi_i_multiply_DEFAULT': ./rational.c:1053: warning: unused parameter 'pmc' ./rational.c:1053: warning: unused parameter 'value' ./rational.c: In function 'Parrot_Rational_multi_divide_DEFAULT_PMC': ./rational.c:1098: warning: unused parameter 'pmc' ./rational.c:1098: warning: unused parameter 'value' ./rational.c:1098: warning: unused parameter 'dest' ./rational.c: In function 'Parrot_Rational_multi_i_divide_Rational': ./rational.c:1123: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_multi_i_divide_DEFAULT': ./rational.c:1135: warning: unused parameter 'pmc' ./rational.c:1135: warning: unused parameter 'value' ./rational.c: In function 'Parrot_Rational_multi_cmp_Float': ./rational.c:1156: warning: unused parameter 'pmc' ./rational.c:1156: warning: unused parameter 'value' ./rational.c: In function 'Parrot_Rational_multi_cmp_Rational': ./rational.c:1169: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_multi_cmp_DEFAULT': ./rational.c:1181: warning: unused parameter 'pmc' ./rational.c:1181: warning: unused parameter 'value' ./rational.c: In function 'Parrot_Rational_multi_is_equal_Float': ./rational.c:1210: warning: unused parameter 'pmc' ./rational.c:1210: warning: unused parameter 'value' ./rational.c: In function 'Parrot_Rational_multi_is_equal_Rational': ./rational.c:1221: warning: unused parameter 'interp' ./rational.c: In function 'Parrot_Rational_multi_is_equal_DEFAULT': ./rational.c:1233: warning: unused parameter 'pmc' ./rational.c:1233: warning: unused parameter 'value' ./rational.pmc: At top level: ./rational.pmc:239: warning: 'rat_power_int' defined but not used gcc -o rational.so rational.o -Wl,-L /builddir/build/BUILD/parrot-1.0.0/blib/lib -L/usr/local/lib -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump md2.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c md2.pmc gcc -c -o md2.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO md2.c ./md2.c: In function 'Parrot_MD2_destroy': ./md2.c:72: warning: unused parameter 'interp' ./md2.c: In function 'Parrot_MD2_init': ./md2.c:86: warning: unused parameter 'interp' ./md2.c: In function 'Parrot_MD2_nci_Init': ./md2.c:101: warning: unused parameter 'pmc' ./md2.c: In function 'Parrot_MD2_nci_Update': ./md2.c:183: warning: unused parameter 'pmc' ./md2.c: In function 'Parrot_MD2_nci_Final': ./md2.c:267: warning: unused parameter 'pmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump md4.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c md4.pmc gcc -c -o md4.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO md4.c ./md4.c: In function 'Parrot_MD4_destroy': ./md4.c:72: warning: unused parameter 'interp' ./md4.c: In function 'Parrot_MD4_init': ./md4.c:86: warning: unused parameter 'interp' ./md4.c: In function 'Parrot_MD4_nci_Init': ./md4.c:101: warning: unused parameter 'pmc' ./md4.c: In function 'Parrot_MD4_nci_Update': ./md4.c:183: warning: unused parameter 'pmc' ./md4.c: In function 'Parrot_MD4_nci_Final': ./md4.c:267: warning: unused parameter 'pmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump md5.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c md5.pmc gcc -c -o md5.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO md5.c ./md5.c: In function 'Parrot_MD5_destroy': ./md5.c:72: warning: unused parameter 'interp' ./md5.c: In function 'Parrot_MD5_init': ./md5.c:86: warning: unused parameter 'interp' ./md5.c: In function 'Parrot_MD5_nci_Init': ./md5.c:101: warning: unused parameter 'pmc' ./md5.c: In function 'Parrot_MD5_nci_Update': ./md5.c:183: warning: unused parameter 'pmc' ./md5.c: In function 'Parrot_MD5_nci_Final': ./md5.c:267: warning: unused parameter 'pmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump ripemd160.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c ripemd160.pmc gcc -c -o ripemd160.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO ripemd160.c ./ripemd160.c: In function 'Parrot_RIPEMD160_destroy': ./ripemd160.c:72: warning: unused parameter 'interp' ./ripemd160.c: In function 'Parrot_RIPEMD160_init': ./ripemd160.c:86: warning: unused parameter 'interp' ./ripemd160.c: In function 'Parrot_RIPEMD160_nci_Init': ./ripemd160.c:101: warning: unused parameter 'pmc' ./ripemd160.c: In function 'Parrot_RIPEMD160_nci_Update': ./ripemd160.c:183: warning: unused parameter 'pmc' ./ripemd160.c: In function 'Parrot_RIPEMD160_nci_Final': ./ripemd160.c:267: warning: unused parameter 'pmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump sha.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c sha.pmc gcc -c -o sha.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO sha.c ./sha.c: In function 'Parrot_SHA_destroy': ./sha.c:72: warning: unused parameter 'interp' ./sha.c: In function 'Parrot_SHA_init': ./sha.c:86: warning: unused parameter 'interp' ./sha.c: In function 'Parrot_SHA_nci_Init': ./sha.c:101: warning: unused parameter 'pmc' ./sha.c: In function 'Parrot_SHA_nci_Update': ./sha.c:183: warning: unused parameter 'pmc' ./sha.c: In function 'Parrot_SHA_nci_Final': ./sha.c:267: warning: unused parameter 'pmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump sha1.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c sha1.pmc gcc -c -o sha1.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO sha1.c ./sha1.c: In function 'Parrot_SHA1_destroy': ./sha1.c:72: warning: unused parameter 'interp' ./sha1.c: In function 'Parrot_SHA1_init': ./sha1.c:86: warning: unused parameter 'interp' ./sha1.c: In function 'Parrot_SHA1_nci_Init': ./sha1.c:101: warning: unused parameter 'pmc' ./sha1.c: In function 'Parrot_SHA1_nci_Update': ./sha1.c:183: warning: unused parameter 'pmc' ./sha1.c: In function 'Parrot_SHA1_nci_Final': ./sha1.c:267: warning: unused parameter 'pmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump sha256.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c sha256.pmc gcc -c -o sha256.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO sha256.c ./sha256.c: In function 'Parrot_SHA256_destroy': ./sha256.c:72: warning: unused parameter 'interp' ./sha256.c: In function 'Parrot_SHA256_init': ./sha256.c:86: warning: unused parameter 'interp' ./sha256.c: In function 'Parrot_SHA256_nci_Init': ./sha256.c:101: warning: unused parameter 'pmc' ./sha256.c: In function 'Parrot_SHA256_nci_Update': ./sha256.c:183: warning: unused parameter 'pmc' ./sha256.c: In function 'Parrot_SHA256_nci_Final': ./sha256.c:267: warning: unused parameter 'pmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump sha512.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c sha512.pmc gcc -c -o sha512.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO sha512.c ./sha512.c: In function 'Parrot_SHA512_destroy': ./sha512.c:72: warning: unused parameter 'interp' ./sha512.c: In function 'Parrot_SHA512_init': ./sha512.c:86: warning: unused parameter 'interp' ./sha512.c: In function 'Parrot_SHA512_nci_Init': ./sha512.c:101: warning: unused parameter 'pmc' ./sha512.c: In function 'Parrot_SHA512_nci_Update': ./sha512.c:183: warning: unused parameter 'pmc' ./sha512.c: In function 'Parrot_SHA512_nci_Final': ./sha512.c:267: warning: unused parameter 'pmc' /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --library digest_group --c md2.pmc md4.pmc md5.pmc ripemd160.pmc sha.pmc sha1.pmc sha256.pmc sha512.pmc gcc -c -o lib-digest_group.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO digest_group.c gcc -o digest_group.so lib-digest_group.o md2.o md4.o md5.o ripemd160.o sha.o sha1.o sha256.o sha512.o -Wl,-L /builddir/build/BUILD/parrot-1.0.0/blib/lib -L/usr/local/lib -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -lcrypto /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --dump subproxy.pmc /usr/bin/perl /builddir/build/BUILD/parrot-1.0.0/tools/build/pmc2c.pl --c subproxy.pmc gcc -c -o subproxy.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO subproxy.c ./subproxy.c: In function 'Parrot_SubProxy_set_pmc': ./subproxy.c:91: warning: unused parameter 'interp' gcc -o subproxy.so subproxy.o -Wl,-L /builddir/build/BUILD/parrot-1.0.0/blib/lib -L/usr/local/lib -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -MExtUtils::Command -e cp *.so /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/dynext gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/src/dynpmc' gmake -C src/dynoplibs gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/src/dynoplibs' /usr/bin/perl -I/builddir/build/BUILD/parrot-1.0.0/lib /builddir/build/BUILD/parrot-1.0.0/tools/build/ops2c.pl CGoto --dynamic myops.ops gcc -c -o myops_ops_cg.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO myops_ops_cg.c gcc -o myops_ops_cg.so myops_ops_cg.o -L/usr/local/lib -L/usr/local/lib -Wl,-E -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -I/builddir/build/BUILD/parrot-1.0.0/lib /builddir/build/BUILD/parrot-1.0.0/tools/build/ops2c.pl CGP --dynamic myops.ops gcc -c -o myops_ops_cgp.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO myops_ops_cgp.c gcc -o myops_ops_cgp.so myops_ops_cgp.o -L/usr/local/lib -L/usr/local/lib -Wl,-E -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -I/builddir/build/BUILD/parrot-1.0.0/lib /builddir/build/BUILD/parrot-1.0.0/tools/build/ops2c.pl C --dynamic myops.ops gcc -c -o myops_ops.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO myops_ops.c myops.ops: In function 'Parrot_hcf': myops.ops:49: warning: unused parameter 'cur_opcode' myops.ops:49: warning: unused parameter 'interp' myops.ops: In function 'Parrot_q': myops.ops:60: warning: unused parameter 'cur_opcode' gcc -o myops_ops.so myops_ops.o -L/usr/local/lib -L/usr/local/lib -Wl,-E -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -I/builddir/build/BUILD/parrot-1.0.0/lib /builddir/build/BUILD/parrot-1.0.0/tools/build/ops2c.pl CSwitch --dynamic myops.ops gcc -c -o myops_ops_switch.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO myops_ops_switch.c myops.ops: In function 'switch_myops': myops_ops_switch.c:66: warning: label 'SWITCH_RELOAD' defined but not used gcc -o myops_ops_switch.so myops_ops_switch.o -L/usr/local/lib -L/usr/local/lib -Wl,-E -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -I/builddir/build/BUILD/parrot-1.0.0/lib /builddir/build/BUILD/parrot-1.0.0/tools/build/ops2c.pl CGoto --dynamic dan.ops gcc -c -o dan_ops_cg.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO dan_ops_cg.c gcc -o dan_ops_cg.so dan_ops_cg.o -L/usr/local/lib -L/usr/local/lib -Wl,-E -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -I/builddir/build/BUILD/parrot-1.0.0/lib /builddir/build/BUILD/parrot-1.0.0/tools/build/ops2c.pl CGP --dynamic dan.ops gcc -c -o dan_ops_cgp.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO dan_ops_cgp.c gcc -o dan_ops_cgp.so dan_ops_cgp.o -L/usr/local/lib -L/usr/local/lib -Wl,-E -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -I/builddir/build/BUILD/parrot-1.0.0/lib /builddir/build/BUILD/parrot-1.0.0/tools/build/ops2c.pl C --dynamic dan.ops gcc -c -o dan_ops.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO dan_ops.c gcc -o dan_ops.so dan_ops.o -L/usr/local/lib -L/usr/local/lib -Wl,-E -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -I/builddir/build/BUILD/parrot-1.0.0/lib /builddir/build/BUILD/parrot-1.0.0/tools/build/ops2c.pl CSwitch --dynamic dan.ops gcc -c -o dan_ops_switch.o -I/builddir/build/BUILD/parrot-1.0.0/include -I/builddir/build/BUILD/parrot-1.0.0/src/pmc -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -fPIC -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO dan_ops_switch.c dan.ops: In function 'switch_dan': dan_ops_switch.c:68: warning: label 'SWITCH_RELOAD' defined but not used gcc -o dan_ops_switch.so dan_ops_switch.o -L/usr/local/lib -L/usr/local/lib -Wl,-E -shared -O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DPERL_USE_SAFE_PUTENV -L/usr/local/lib -fPIC -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline /usr/bin/perl -MExtUtils::Command -e cp *.so /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/dynext gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/src/dynoplibs' gmake -C compilers/pct gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pct' ../../parrot -o ../../runtime/parrot/library/PCT.pbc --output-pbc PCT.pir ../../parrot -o ../../runtime/parrot/library/PCT/PAST.pbc --output-pbc src/PAST.pir ../../parrot -o ../../runtime/parrot/library/PCT/Grammar.pbc --output-pbc src/PCT/Grammar.pir ../../parrot -o ../../runtime/parrot/library/PCT/HLLCompiler.pbc --output-pbc src/PCT/HLLCompiler.pir gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pct' gmake -C compilers/pge gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pge' /usr/bin/perl -MExtUtils::Command -e rm_f PGE.pbc ../../runtime/parrot/library/PGE.pbc /usr/bin/perl -e "" >PGE/builtins_gen.pir ../../parrot -o PGE.pbc --output-pbc PGE.pir ../../parrot ../../runtime/parrot/library/PGE/Perl6Grammar.pir --output=PGE/builtins_gen.pir PGE/builtins.pg /usr/bin/perl -MExtUtils::Command -e rm_f PGE.pbc ../../parrot -o PGE.pbc --output-pbc PGE.pir /usr/bin/perl -MExtUtils::Command -e cp PGE.pbc ../../runtime/parrot/library gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pge' gmake -C compilers/tge gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/tge' ../../parrot ../../runtime/parrot/library/PGE/Perl6Grammar.pbc --output=TGE/Parser.pir TGE/Parser.pg ../../parrot -o ../../runtime/parrot/library/TGE.pbc --output-pbc TGE.pir gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/tge' gmake -C compilers/nqp gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/nqp' ../../parrot /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/library/PGE/Perl6Grammar.pir \ --output=src/Grammar_gen.pir src/Grammar.pg ../../parrot -o nqp.pbc nqp.pir gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/nqp' gmake -C compilers/json gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/json' ../../parrot ../../runtime/parrot/library/PGE/Perl6Grammar.pbc --output=JSON/grammar.pir JSON/grammar.pg ../../parrot --output=JSON/grammar.pbc JSON/grammar.pir ../../parrot ../../compilers/tge/tgc.pir --output=JSON/pge2pir.pir JSON/pge2pir.tg ../../parrot --output=JSON/pge2pir.pbc JSON/pge2pir.pir ../../parrot --output=JSON.pbc JSON.pir gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/json' src/pbc_disassemble.c gcc -o pbc_disassemble \ src/pbc_disassemble.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E ./parrot -o pbc_to_exe.pbc tools/dev/pbc_to_exe.pir ./parrot pbc_to_exe.pbc pbc_to_exe.pbc gcc -o pbc_to_exe.o -I/builddir/build/BUILD/parrot-1.0.0/include -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -c pbc_to_exe.c pbc_to_exe.c:3: warning: size of 'program_code' is 11680 bytes Compiled: pbc_to_exe.o gcc -o pbc_to_exe pbc_to_exe.o /builddir/build/BUILD/parrot-1.0.0/src/parrot_config.o -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -Wl,-E -Wl,-rpath,/usr/lib/perl5/5.10.0/ppc-linux-thread-multi/CORE -L/usr/local/lib -Wl,-E -lcurses -lm -lgmp -lreadline -licuuc -licudata -lpthread -lm Linked: pbc_to_exe ./parrot -o parrot_config.pbc tools/util/parrot-config.pir ./parrot pbc_to_exe.pbc parrot_config.pbc gcc -o parrot_config.o -I/builddir/build/BUILD/parrot-1.0.0/include -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -c parrot_config.c Compiled: parrot_config.o gcc -o parrot_config parrot_config.o /builddir/build/BUILD/parrot-1.0.0/src/parrot_config.o -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -Wl,-E -Wl,-rpath,/usr/lib/perl5/5.10.0/ppc-linux-thread-multi/CORE -L/usr/local/lib -Wl,-E -lcurses -lm -lgmp -lreadline -licuuc -licudata -lpthread -lm Linked: parrot_config src/pbc_merge.c gcc -o pbc_merge \ src/pbc_merge.o \ src/parrot_config.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -Wl,-E -Wl,-rpath,/usr/lib/perl5/5.10.0/ppc-linux-thread-multi/CORE -L/usr/local/lib -Wl,-E src/parrot_debugger.c gcc -o parrot_debugger \ src/parrot_debugger.o \ src/parrot_config.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E src/pbc_dump.c src/packdump.c gcc -o pbc_dump \ src/pbc_dump.o \ src/packdump.o -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E src/pbc_info.c src/pbc_info.c: In function 'main': src/pbc_info.c:65: warning: unused parameter 'argc' gcc -o pbc_info \ src/pbc_info.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E + make parrot_utils make: Nothing to be done for `parrot_utils'. + make installable Compiling with: xx.c gcc -I./include -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO -fPIC -I. -o xx.o -c xx.c gmake -C docs gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/docs' /usr/bin/perl -MExtUtils::Command -e mkpath ops gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/docs' gmake -C src/dynpmc gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/src/dynpmc' /usr/bin/perl -MExtUtils::Command -e cp *.so /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/dynext gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/src/dynpmc' gmake -C src/dynoplibs gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/src/dynoplibs' /usr/bin/perl -MExtUtils::Command -e cp *.so /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/dynext gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/src/dynoplibs' gmake -C compilers/pct gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pct' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pct' gmake -C compilers/pge gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pge' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pge' gmake -C compilers/tge gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/tge' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/tge' gmake -C compilers/nqp gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/nqp' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/nqp' gmake -C compilers/json gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/json' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/json' Invoking Parrot to generate install_config.fpmc ./parrot config_lib.pasm --install > install_config.fpmc /usr/bin/perl tools/build/parrot_config_c.pl --install > \ src/install_config.c src/install_config.c src/install_config.c:22: warning: size of 'parrot_config' is 22204 bytes gcc -o installable_parrot \ src/main.o src/install_config.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E gcc -o installable_pbc_dump \ src/pbc_dump.o \ src/packdump.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E gcc -o installable_pbc_disassemble \ src/pbc_disassemble.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E gcc -o installable_pbc_info \ src/pbc_info.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E gcc -o installable_parrot_debugger \ src/parrot_debugger.o \ src/parrot_config.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E ./parrot -o parrot_config.pbc tools/util/parrot-config.pir ./pbc_to_exe parrot_config.pbc --install gcc -o parrot_config.o -I/builddir/build/BUILD/parrot-1.0.0/include -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -c parrot_config.c Compiled: parrot_config.o gcc -o installable_parrot_config parrot_config.o /builddir/build/BUILD/parrot-1.0.0/src/install_config.o -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -Wl,-E -Wl,-rpath,/usr/lib/perl5/5.10.0/ppc-linux-thread-multi/CORE -L/usr/local/lib -Wl,-E -lcurses -lm -lgmp -lreadline -licuuc -licudata -lpthread -lm Linked: installable_parrot_config gcc -o installable_pbc_merge \ src/pbc_merge.o \ src/install_config.o \ -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -licuuc -licudata -lpthread -lm -lcurses -lm -lgmp -lreadline -L/usr/local/lib -Wl,-E ./pbc_to_exe pbc_to_exe.pbc --install gcc -o pbc_to_exe.o -I/builddir/build/BUILD/parrot-1.0.0/include -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -c pbc_to_exe.c pbc_to_exe.c:3: warning: size of 'program_code' is 11680 bytes Compiled: pbc_to_exe.o gcc -o installable_pbc_to_exe pbc_to_exe.o /builddir/build/BUILD/parrot-1.0.0/src/install_config.o -L/builddir/build/BUILD/parrot-1.0.0/blib/lib -lparrot -Wl,-E -Wl,-rpath,/usr/lib/perl5/5.10.0/ppc-linux-thread-multi/CORE -L/usr/local/lib -Wl,-E -lcurses -lm -lgmp -lreadline -licuuc -licudata -lpthread -lm Linked: installable_pbc_to_exe + make html gmake -C docs html gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/docs' /usr/bin/perl -I../lib ../tools/docs/write_docs.pl --silent --version=1.0.0 gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/docs' + exit 0 Executing(%install): /bin/sh -e /var/tmp/rpm-tmp.21949 + umask 022 + cd /builddir/build/BUILD + cd parrot-1.0.0 + LANG=C + export LANG + unset DISPLAY + rm -rf /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild ++ pwd + export LD_LIBRARY_PATH=/builddir/build/BUILD/parrot-1.0.0/blib/lib + LD_LIBRARY_PATH=/builddir/build/BUILD/parrot-1.0.0/blib/lib + make install-dev DESTDIR=/var/tmp/parrot-1.0.0-6.fc9-root-mockbuild Compiling with: xx.c gcc -I./include -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO -fPIC -I. -o xx.o -c xx.c gmake -C docs gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/docs' /usr/bin/perl -MExtUtils::Command -e mkpath ops gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/docs' gmake -C src/dynpmc gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/src/dynpmc' /usr/bin/perl -MExtUtils::Command -e cp *.so /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/dynext gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/src/dynpmc' gmake -C src/dynoplibs gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/src/dynoplibs' /usr/bin/perl -MExtUtils::Command -e cp *.so /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/dynext gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/src/dynoplibs' gmake -C compilers/pct gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pct' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pct' gmake -C compilers/pge gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pge' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pge' gmake -C compilers/tge gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/tge' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/tge' gmake -C compilers/nqp gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/nqp' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/nqp' gmake -C compilers/json gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/json' gmake[1]: Nothing to be done for `all'. gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/json' /usr/bin/perl tools/dev/install_files.pl \ --buildprefix= \ --prefix=/usr \ --exec-prefix=/usr \ --bindir=/usr/bin \ --libdir=/usr/lib \ --includedir=/usr/include \ --destdir=/var/tmp/parrot-1.0.0-6.fc9-root-mockbuild \ --docdir=/usr/share/doc \ --versiondir=/parrot/1.0.0 \ MANIFEST MANIFEST.generated skipping parrot_debugger, using installable_parrot_debugger instead skipping pbc_disassemble, using installable_pbc_disassemble instead skipping pbc_dump, using installable_pbc_dump instead skipping pbc_info, using installable_pbc_info instead skipping pbc_merge, using installable_pbc_merge instead skipping pbc_to_exe, using installable_pbc_to_exe instead Installing ... /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/LICENSE /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/NEWS /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/PBC_COMPAT /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/RESPONSIBLE_PARTIES /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/P6Rule.grammar /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/PGE.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/PGE/Exp.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/PGE/Match.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/PGE/OPTable.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/PGE/P5Regex.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/PGE/Perl6Regex.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/PGE/Regex.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/PGE/builtins.pg /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/STATUS /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pge/demo.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/faq.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/gettingstarted.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/glossary.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/intro.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/pmc/array.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/pmc/documentation.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/pmc/struct.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/pmc/subs.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/user/pir/exceptions.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/user/pir/intro.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/user/pir/objects.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/user/pir/pmcs.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/atomic.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/atomic/fallback.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/atomic/gcc_pcc.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/atomic/gcc_x86.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/atomic/sparc.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/caches.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/call.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/cclass.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/charset.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/compiler.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/core_types.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/datatypes.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/debugger.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/dynext.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/embed.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/encoding.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/enums.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/events.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/exceptions.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/exec.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/exit.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/extend.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/gc_api.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/gc_mark_sweep.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/gc_pools.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/global.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/global_setup.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/hash.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/hll.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/imcc.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/interpreter.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/io.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/io_portable.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/io_unix.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/io_win32.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/key.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/library.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/list.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/longopt.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/memory.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/misc.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/multidispatch.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/nci.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/oo.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/oo_private.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/op.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/oplib.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/packfile.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/parrot.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/pic.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/pmc.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/pmc_freeze.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/pobj.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/register.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/resources.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/scheduler.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/scheduler_private.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/settings.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/slice.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/stacks.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/stat.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/string.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/string_funcs.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/string_primitives.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/sub.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/thr_pthread.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/thr_windows.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/thread.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/tsq.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/vtables.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/warnings.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/fp_equality.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/hllmacros.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/sockets.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/test_more.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/CGI/QueryHash.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Config/JSON.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Crow.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Data/Dumper.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Data/Dumper/Base.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Data/Dumper/Default.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Data/Replace.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Digest/MD5.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Getopt/Obj.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/HTTP/Daemon.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Iter.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/JSON.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/MIME/Base64.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Math/Rand.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Math/Random/mt19937ar.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/NCI/call_toolkit_init.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/OpenGL.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/P6object.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Dumper.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Glob.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Hs.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Perl6Grammar.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Text.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Util.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Parrot/Coroutine.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Parrot/Exception.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Pg.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Protoobject.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Range.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/App.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Button.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Color.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Constants.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Event.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/EventHandler.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Font.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Image.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/LCD.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/LCD.png /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Rect.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Sprite.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/StopWatch.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/SDL/Surface.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Base.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Combiner.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Coroutine.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Filter.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Lines.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/ParrotIO.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Replay.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Sub.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Writer.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/String/Utils.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Tcl/Glob.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/TclLibrary.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Test/Builder.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Test/Builder/Output.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Test/Builder/Test.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Test/Builder/TestPlan.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Test/Builder/Tester.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Test/Class.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Test/More.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/YAML/Dumper.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/YAML/Dumper/Base.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/YAML/Dumper/Default.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/YAML/Parser/Syck.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/dumper.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/libpcre.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/ncurses.declarations /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/ncurses.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/ncurses.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/parrotlib.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/pcore.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/pcre.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/postgres.declarations /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/postgres.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/postgres.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/random_lib.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/tcpstream.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/uuid.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/yaml_dumper.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/libparrot.a /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/libparrot.so.1.0.0 /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/libparrot.so /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/bit.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/cmp.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/core.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/debug.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/experimental.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/io.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/math.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/object.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/obscure.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/pic.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/pmc.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/set.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/string.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/sys.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/ops/var.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/config.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/core_pmcs.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/extend_vtable.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/feature.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/has_header.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/oplib/core_ops_cg.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/oplib/core_ops_cgp.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/oplib/core_ops.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/oplib/core_ops_switch.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/oplib/ops.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/platform.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/platform_interface.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/vtable.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/config.fpmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/pkgconfig/parrot.pc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/digest_group.so /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/dynlexpad.so /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/gdbmhash.so /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/libnci_test.so /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/rational.so /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/subproxy.so /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/call_bits.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/cclass.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/datatypes.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/errors.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/except_severity.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/except_types.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/iglobals.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/interpcores.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/interpdebug.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/interpflags.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/interpinfo.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/interptrace.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/iterator.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/longopt.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/mmd.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/parrotlib.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/pmctypes.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/signal.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/stat.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/stdio.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/stringinfo.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/sysinfo.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/timer.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/tm.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/include/warnings.pasm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/CGI/QueryHash.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/config.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/config.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Data/Dumper/Base.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Data/Dumper/Default.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Data/Dumper.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/dumper.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Getopt/Obj.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Math/Random/mt19937ar.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Math/Rand.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/MIME/Base64.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/NCI/call_toolkit_init.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/ncurses.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/P6object.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Parrot/Coroutine.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Parrot/Exception.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/parrotlib.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/pcre.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Dumper.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Glob.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Perl6Grammar.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Text.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PGE/Util.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Protoobject.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Base.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Combiner.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Coroutine.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Filter.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Lines.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/ParrotIO.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Replay.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Sub.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/Stream/Writer.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/parrot_config /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/parrot_debugger /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/parrot /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_disassemble /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_info /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_merge /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_to_exe /usr/bin/perl tools/dev/install_dev_files.pl \ --buildprefix= \ --prefix=/usr \ --exec-prefix=/usr \ --bindir=/usr/bin \ --libdir=/usr/lib \ --includedir=/usr/include \ --destdir=/var/tmp/parrot-1.0.0-6.fc9-root-mockbuild \ --docdir=/usr/share/doc \ --datadir=/usr/share \ --srcdir=/usr/src \ --versiondir=/parrot/1.0.0 \ MANIFEST MANIFEST.generated Installing ... /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/PLATFORMS /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/README /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/VERSION /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/nqp/TODO.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/nqp/bootstrap/actions.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/nqp/bootstrap/nqp.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/nqp/nqp.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/nqp/src/Grammar.pg /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/nqp/src/Grammar/Actions.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/nqp/src/builtins.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/PCT.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/src/PAST.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/src/PAST/Compiler.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/src/PAST/Node.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/src/PCT/Grammar.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/src/PCT/HLLCompiler.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/src/PCT/Node.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/src/POST/Compiler.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/pct/src/POST/Node.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/tge/TGE.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/tge/TGE/Compiler.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/tge/TGE/Grammar.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/tge/TGE/Parser.pg /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/tge/TGE/Rule.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/tge/TGE/Tree.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/tge/tgc.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/compiler_faq.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/debug.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/pct/gettingstarted.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/pct/past_building_blocks.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/pct/pct_optable_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/pmc2c.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/branching_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/cage_cleaners_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/committer_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/debian_packaging_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/metacommitter_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/pause_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/release_manager_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/roles_responsibilities.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/support_policy.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/ticket_triaging.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/project/ubuntu_packaging_guide.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot/1.0.0/pod/vtables.pod /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/File/Which.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/BuildUtil.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Config.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Compiler.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Data.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Messages.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Options.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Options/Conf.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Options/Conf/CLI.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Options/Conf/File.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Options/Conf/Shared.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Options/Reconf.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Options/Test.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Options/Test/Prepare.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Step.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Step/List.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Step/Methods.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Test.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Trace.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Configure/Utils.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Distribution.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Directory.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/File.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Group.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/HTMLPage.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Item.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/POD2HTML.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/C.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Compilers.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Config.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Developer.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Examples.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/IMCC.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Info.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Libs.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Ops.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/PDDs.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/PMCs.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Parrot.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Perl.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Tests.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Section/Tools.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Docs/Text2HTML.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Harness/DefaultTests.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Harness/Options.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Harness/Smoke.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Headerizer.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/IO/Directory.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/IO/File.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/IO/Path.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Manifest.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Op.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpTrans.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpTrans/C.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpTrans/CGP.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpTrans/CGoto.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpTrans/CPrederef.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpTrans/CSwitch.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpTrans/Compiled.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Ops2c/Auxiliary.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Ops2c/Utils.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Ops2pm.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Ops2pm/Auxiliary.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Ops2pm/Base.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpsFile.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpsRenumber.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/Attribute.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/ComposedMethod.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/Dumper.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/Emitter.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/Library.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/MULTI.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/Method.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/MethodEmitter.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/Object.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PCCMETHOD.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC/Null.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC/Object.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC/ParrotClass.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC/PrintTree.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC/RO.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC/Ref.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC/SharedRef.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMC/default.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PMCEmitter.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/Parser.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/Pmc2cMain.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/UtilFunctions.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/VTable.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Revision.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/SearchOps.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/Cardinal.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/Harness.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/PGE.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/PIR_PGE.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/Perl6.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/Pod.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/Pod/Utils.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/Util.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Test/Util/Runloop.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Vtable.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/dynpmc/dynlexpad.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/dynpmc/foo.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/dynpmc/gdbmhash.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/dynpmc/pair.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/dynpmc/rational.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/dynpmc/rotest.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/dynpmc/subproxy.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/ops/ops.num /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/addrregistry.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/array.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/bigint.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/bignum.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/boolean.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/bound_nci.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/callsignature.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/capture.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/class.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/codestring.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/complex.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/continuation.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/coroutine.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/cpointer.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/default.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/env.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/eval.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/eventhandler.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/exception.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/exceptionhandler.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/exporter.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/file.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/filehandle.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/fixedbooleanarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/fixedfloatarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/fixedintegerarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/fixedpmcarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/fixedstringarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/float.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/hash.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/integer.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/iterator.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/key.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/lexinfo.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/lexpad.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/managedstruct.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/multisub.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/namespace.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/nci.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/null.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/object.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/orderedhash.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/os.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfile.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfileannotation.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfileannotationkeys.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfileannotations.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfileconstanttable.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfiledirectory.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfilefixupentry.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfilefixuptable.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfilerawsegment.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/packfilesegment.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/parrotinterpreter.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/parrotlibrary.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/parrotrunningthread.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/parrotthread.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/pccmethod_test.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/pmcproxy.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/pointer.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/random.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/ref.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/resizablebooleanarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/resizablefloatarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/resizableintegerarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/resizablepmcarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/resizablestringarray.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/retcontinuation.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/role.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/scalar.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/scheduler.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/schedulermessage.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/sharedref.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/slice.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/string.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/stringhandle.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/sub.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/task.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/timer.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/undef.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/unmanagedstruct.pmc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/vtable.tbl /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/build/ops2c.pl /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/build/pmc2c.pl /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/dev/gen_makefile.pl /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/dev/pbc_to_exe.pir /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/dev/reconfigure.pl /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/languages/nqp/nqp.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/pbcversion.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/parrot/platform_limits.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Config/Generated.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpLib/core.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/Pmc2c/PCCMETHOD_BITS.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/PMC.pm /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PCT/Grammar.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PCT/HLLCompiler.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PCT/PAST.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/PCT.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/library/TGE.pbc /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/call_list.txt /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/boolean.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/continuation.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/default.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/fixedpmcarray.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/float.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/hash.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/integer.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/multisub.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_boolean.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_continuation.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_default.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_fixedintegerarray.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_fixedpmcarray.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_float.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_hash.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_integer.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_multisub.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_object.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_parrotlibrary.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_resizablepmcarray.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_scalar.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_string.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_sub.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/parrot/1.0.0/pmc/pmc_undef.h /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/resizablepmcarray.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/scalar.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/string.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/sub.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/pmc/undef.dump /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src/parrot/1.0.0/vtable.dump + rm -rf /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot + find docs examples -type d -exec chmod 755 '{}' ';' + find docs examples -type f -exec chmod 644 '{}' ';' + find /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext -type f -name '*.so' -exec chmod 755 '{}' ';' + rm -rf /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/File + find /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools -type f -name '*.pl' -exec chmod 755 '{}' ';' -exec /bin/sed -i -e '1 s&#! perl&#!/usr/bin/perl&' '{}' ';' + find /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/dev -type f -name pbc_to_exe.pir -exec /bin/sed -i -e '1 s&#! parrot&#!/usr/bin/parrot&' '{}' ';' -exec chmod 755 '{}' ';' + rm -rf /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/tools/lib/Parrot/OpLib + find docs/html -type f -size 0 -exec rm -f '{}' ';' + find examples -type f -name '*.pl' -exec /bin/sed -i -e '1 s&#! perl&#!/usr/bin/perl&' '{}' ';' + find examples -wholename examples/pir/befunge/t/basic.t -exec /bin/sed -i -e '1 s&#! perl&#!/usr/bin/perl&' '{}' ';' + find examples -type f -name '*.py' -exec /bin/sed -i -e '1 s&#! python&#!/usr/bin/python&' '{}' ';' + find examples -type f -name '*.rb' -exec /bin/sed -i -e '1 s&#! ruby&#!/usr/bin/ruby&' '{}' ';' + find examples -type f -name '*.pir' -exec /bin/sed -i -e '1 s&#!./parrot&#!/usr/bin/parrot&' '{}' ';' + find examples/shootout -type f -name random.pasm -exec /bin/sed -i -e '1 s&#!./parrot&#!/usr/bin/parrot&' '{}' ';' + find examples -wholename examples/languages/abc/t/01-tests.t -exec /bin/sed -i -e '1 s&#!perl&#!/usr/bin/perl&' '{}' ';' + find examples -wholename examples/shootout/revcomp.pir -exec /bin/sed -i -e '1 s&#!parrot&#!/usr/bin/parrot&' '{}' ';' + find examples -wholename examples/languages/abc/t/harness -exec /usr/bin/perl -pi -e 's/\r$//' '{}' ';' + find examples/languages -type f -name harness -exec /bin/sed -i -e '1 s&#! perl&#!/usr/bin/perl&' '{}' ';' + for file in docs/book/ch09_pct.pod docs/memory_internals.pod + /bin/mv docs/book/ch09_pct.pod timestamp + iconv -f ISO-8859-1 -t UTF-8 -o docs/book/ch09_pct.pod timestamp + touch -r timestamp docs/book/ch09_pct.pod + for file in docs/book/ch09_pct.pod docs/memory_internals.pod + /bin/mv docs/memory_internals.pod timestamp + iconv -f ISO-8859-1 -t UTF-8 -o docs/memory_internals.pod timestamp + touch -r timestamp docs/memory_internals.pod + /bin/rm -f timestamp + rm -rf /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/config /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/include/src /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/src + /usr/lib/rpm/find-debuginfo.sh /builddir/build/BUILD/parrot-1.0.0 extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/digest_group.so extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/dynlexpad.so extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/gdbmhash.so extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/libnci_test.so extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/rational.so extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/parrot/1.0.0/dynext/subproxy.so extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/lib/libparrot.so.1.0.0 extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/parrot_config extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/parrot_debugger extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/parrot extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_disassemble extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_dump extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_info extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_merge extracting debug info from /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/bin/pbc_to_exe symlinked /usr/lib/debug/usr/lib/libparrot.so.1.0.0.debug to /usr/lib/debug/usr/lib/libparrot.so.debug cpio: gcc-4.3.0-20080428/obj-ppc64-redhat-linux/ppc64-redhat-linux/libgcc/crtsavres.S: Cannot stat: No such file or directory 30216 blocks + /usr/lib/rpm/check-buildroot + /usr/lib/rpm/redhat/brp-compress + /usr/lib/rpm/redhat/brp-strip-static-archive /usr/bin/strip + /usr/lib/rpm/redhat/brp-strip-comment-note /usr/bin/strip /usr/bin/objdump + /usr/lib/rpm/brp-python-bytecompile + /usr/lib/rpm/redhat/brp-python-hardlink + /usr/lib/rpm/redhat/brp-java-repack-jars Executing(%check): /bin/sh -e /var/tmp/rpm-tmp.7390 + umask 022 + cd /builddir/build/BUILD + cd parrot-1.0.0 ++ pwd + export LD_LIBRARY_PATH=/builddir/build/BUILD/parrot-1.0.0/blib/lib + LD_LIBRARY_PATH=/builddir/build/BUILD/parrot-1.0.0/blib/lib + FULL=full + make fulltest gmake testb \ testC \ testf \ testg \ testj \ testr \ testS \ src_tests \ run_tests \ perl_tests \ codetest \ benchmark_tests \ manifest_tests \ examples_tests \ distro_tests gmake[1]: Entering directory `/builddir/build/BUILD/parrot-1.0.0' Compiling with: xx.c gcc -I./include -D_REENTRANT -D_GNU_SOURCE -DDEBUGGING -pipe -I/usr/local/include -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -I/usr/include/gdbm -DHASATTRIBUTE_CONST -DHASATTRIBUTE_DEPRECATED -DHASATTRIBUTE_MALLOC -DHASATTRIBUTE_NONNULL -DHASATTRIBUTE_NORETURN -DHASATTRIBUTE_PURE -DHASATTRIBUTE_UNUSED -DHASATTRIBUTE_WARN_UNUSED_RESULT -falign-functions=16 -fvisibility=hidden -funit-at-a-time -W -Wall -Waggregate-return -Wcast-align -Wcast-qual -Wchar-subscripts -Wcomment -Wdisabled-optimization -Wendif-labels -Wextra -Wformat -Wformat-extra-args -Wformat-nonliteral -Wformat-security -Wformat-y2k -Wimplicit -Wimport -Winit-self -Winline -Winvalid-pch -Wlogical-op -Wmissing-braces -Wmissing-field-initializers -Wno-missing-format-attribute -Wmissing-include-dirs -Wpacked -Wparentheses -Wpointer-arith -Wreturn-type -Wsequence-point -Wno-shadow -Wsign-compare -Wstrict-aliasing -Wstrict-aliasing=2 -Wswitch -Wswitch-default -Wtrigraphs -Wundef -Wunknown-pragmas -Wno-unused -Wvariadic-macros -Wwrite-strings -Wlarger-than-4096 -Wbad-function-cast -Wc++-compat -Wdeclaration-after-statement -Werror=declaration-after-statement -Wimplicit-function-declaration -Wimplicit-int -Wmain -Wmissing-declarations -Wmissing-prototypes -Wnested-externs -Wnonnull -DDISABLE_GC_DEBUG=1 -DNDEBUG -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector --param=ssp-buffer-size=4 -m32 -DHAS_GETTEXT -DHAS_JIT -DPPC -DHAVE_COMPUTED_GOTO -fPIC -I. -o xx.o -c xx.c gmake -C docs gmake[2]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/docs' /usr/bin/perl -MExtUtils::Command -e mkpath ops gmake[2]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/docs' gmake -C src/dynpmc gmake[2]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/src/dynpmc' /usr/bin/perl -MExtUtils::Command -e cp *.so /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/dynext gmake[2]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/src/dynpmc' gmake -C src/dynoplibs gmake[2]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/src/dynoplibs' /usr/bin/perl -MExtUtils::Command -e cp *.so /builddir/build/BUILD/parrot-1.0.0/runtime/parrot/dynext gmake[2]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/src/dynoplibs' gmake -C compilers/pct gmake[2]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pct' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pct' gmake -C compilers/pge gmake[2]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pge' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/pge' gmake -C compilers/tge gmake[2]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/tge' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/tge' gmake -C compilers/nqp gmake[2]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/nqp' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/nqp' gmake -C compilers/json gmake[2]: Entering directory `/builddir/build/BUILD/parrot-1.0.0/compilers/json' gmake[2]: Nothing to be done for `all'. gmake[2]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0/compilers/json' /usr/bin/perl t/harness --gc-debug --running-make-test -b --runcore-tests t/compilers/imcc/imcpasm/cfg.t ......... ok t/compilers/imcc/imcpasm/opt0.t ........ ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.t ........ ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.t ........ ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.t ........ not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc.t ......... ok t/compilers/imcc/imcpasm/sub.t ......... ok t/compilers/imcc/reg/alloc.t ........... ok t/compilers/imcc/reg/spill.t ........... ok t/compilers/imcc/syn/bsr.t ............. ok t/compilers/imcc/syn/clash.t ........... not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.t ........... ok t/compilers/imcc/syn/errors.t .......... ok t/compilers/imcc/syn/eval.t ............ ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.t ............ ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll.t ............. ok t/compilers/imcc/syn/keyed.t ........... ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels.t .......... ok t/compilers/imcc/syn/macro.t ........... ok t/compilers/imcc/syn/objects.t ......... ok t/compilers/imcc/syn/op.t .............. ok t/compilers/imcc/syn/pasm.t ............ ok t/compilers/imcc/syn/pcc.t ............. ok t/compilers/imcc/syn/pod.t ............. ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions.t ..... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.t ........... ok t/compilers/imcc/syn/subflags.t ........ not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols.t ......... ok t/compilers/imcc/syn/tail.t ............ ok t/compilers/imcc/syn/veracity.t ........ ok t/op/00ff-dos.t ........................ ok t/op/00ff-unix.t ....................... ok t/op/01-parse_ops.t .................... ok t/op/64bit.t ........................... skipped: 64bit INTVAL platforms only t/op/annotate.t ........................ ok t/op/arithmetics.t ..................... ok t/op/basic.t ........................... ok t/op/bitwise.t ......................... ok t/op/box.t ............................. ok t/op/calling.t ......................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.t ....................... ok t/op/cc_state.t ........................ not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.t ................... ok t/op/comp.t ............................ ok t/op/copy.t ............................ ok t/op/debuginfo.t ....................... ok t/op/exceptions.t ...................... not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc.t .............................. ok t/op/globals.t ......................... ok t/op/hacks.t ........................... ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless.t ........................ ok t/op/integer.t ......................... ok t/op/interp.t .......................... ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io.t .............................. ok t/op/jit.t ............................. ok t/op/jitn.t ............................ ok t/op/lexicals.t ........................ not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal.t ......................... ok t/op/load_bytecode.t ................... ok t/op/number.t .......................... ok t/op/pushaction.t ...................... not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say.t ............................. ok t/op/spawnw.t .......................... ok t/op/sprintf.t ......................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2.t ........................ ok t/op/string.t .......................... ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass.t ................... ok t/op/string_cs.t ....................... ok t/op/string_mem.t ...................... ok t/op/stringu.t ......................... ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo.t ......................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok t/op/time.t ............................ ok t/op/trans.t ........................... ok t/pmc/addrregistry.t ................... ok t/pmc/array.t .......................... not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint.t ......................... ok t/pmc/bignum.t ......................... not ok 4 - set double, get str # TODO bignum strings not ok 5 - add # TODO bignum strings not ok 6 - add_int # TODO bignum strings not ok 10 - mul # TODO bignum strings not ok 11 - mul_float # TODO bignum strings not ok 16 - bignum / by zero BigInt # TODO missing signature not ok 18 - bignum % by zero BigNum # TODO missing signature not ok 19 - bignum % by zero BigInt # TODO missing signature not ok 20 - bignum % by zero Integer # TODO missing signature not ok 23 - abs # TODO bignum strings ok t/pmc/boolean.t ........................ ok t/pmc/bound_nci.t ...................... ok t/pmc/callsignature.t .................. ok t/pmc/capture.t ........................ ok t/pmc/class.t .......................... not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.t ..................... ok t/pmc/complex.t ........................ ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config.t ......................... ok t/pmc/continuation.t ................... ok t/pmc/coroutine.t ...................... not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.t ....................... ok t/pmc/default.t ........................ not ok 1 - new # TODO not implemeted ok t/pmc/env.t ............................ ok t/pmc/eval.t ........................... ok t/pmc/eventhandler.t ................... ok t/pmc/exception.t ...................... not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow ok 30 # SKIP intermittent segfault, RT #60556 ok t/pmc/exceptionhandler.t ............... ok t/pmc/exporter.t ....................... ok t/pmc/file.t ........................... ok t/pmc/filehandle.t ..................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray.t .............. ok t/pmc/fixedfloatarray.t ................ ok t/pmc/fixedintegerarray.t .............. ok t/pmc/fixedpmcarray.t .................. ok t/pmc/fixedstringarray.t ............... ok t/pmc/float.t .......................... ok t/pmc/freeze.t ......................... ok t/pmc/globals.t ........................ ok t/pmc/hash.t ........................... ok t/pmc/integer.t ........................ ok t/pmc/io.t ............................. not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet ok 23 # SKIP segfault, see TT #418 not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator.t .................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status.t ...................... not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator.t ....................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.t ............................ not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo.t ........................ ok t/pmc/lexpad.t ......................... ok t/pmc/managedstruct.t .................. ok t/pmc/multidispatch.t .................. not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.t ....................... ok t/pmc/namespace.t ...................... not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci.t ............................ ok t/pmc/null.t ........................... ok t/pmc/object-meths.t ................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.t ..................... ok t/pmc/object.t ......................... ok t/pmc/objects.t ........................ ok t/pmc/orderedhash.t .................... ok t/pmc/os.t ............................. ok t/pmc/packfile.t ....................... ok t/pmc/packfileannotation.t ............. ok t/pmc/packfileannotationkeys.t ......... ok t/pmc/packfileannotations.t ............ ok t/pmc/packfileconstanttable.t .......... not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory.t .............. ok t/pmc/packfilefixupentry.t ............. ok t/pmc/packfilefixuptable.t ............. ok t/pmc/packfilerawsegment.t ............. ok t/pmc/packfilesegment.t ................ ok t/pmc/parrotclass.t .................... ok t/pmc/parrotinterpreter.t .............. ok t/pmc/parrotio.t ....................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary.t .................. ok t/pmc/parrotobject.t ................... ok t/pmc/parrotrunningthread.t ............ ok t/pmc/parrotthread.t ................... ok t/pmc/pccmethod_test.t ................. ok t/pmc/pmc.t ............................ ok t/pmc/pmcproxy.t ....................... ok t/pmc/pointer.t ........................ ok t/pmc/prop.t ........................... ok t/pmc/random.t ......................... ok t/pmc/ref.t ............................ ok t/pmc/resizablebooleanarray.t .......... ok t/pmc/resizablefloatarray.t ............ ok t/pmc/resizableintegerarray.t .......... ok t/pmc/resizablepmcarray.t .............. ok t/pmc/resizablestringarray.t ........... ok t/pmc/retcontinuation.t ................ ok t/pmc/ro.t ............................. not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.t ........................... ok t/pmc/scalar.t ......................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler.t ...................... ok t/pmc/schedulermessage.t ............... ok t/pmc/sharedref.t ...................... ok t/pmc/signal.t ......................... skipped: Signals currently disabled t/pmc/slice.t .......................... not ok 2 - bug with slice bits # TODO parser ok t/pmc/string.t ......................... ok t/pmc/stringhandle.t ................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub.t ............................ ok t/pmc/sys.t ............................ ok t/pmc/task.t ........................... ok t/pmc/threads.t ........................ not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer.t .......................... ok t/pmc/undef.t .......................... ok t/pmc/unmanagedstruct.t ................ ok t/oo/attributes.t ...................... ok t/oo/composition.t ..................... ok t/oo/inheritance.t ..................... ok t/oo/isa.t ............................. ok t/oo/metamodel.t ....................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods.t ......................... ok t/oo/mro-c3.t .......................... ok t/oo/names.t ........................... ok t/oo/new.t ............................. ok t/oo/ops.t ............................. ok t/oo/proxy.t ........................... ok t/oo/subclass.t ........................ ok t/oo/vtableoverride.t .................. ok t/native_pbc/header.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/integer.t ................. skipped: pending robust testing strategy, TT #357 t/native_pbc/number.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/string.t .................. skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad.t ................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo.t ......................... ok t/dynpmc/gdbmhash.t .................... ok t/dynpmc/md2.t ......................... ok t/dynpmc/md4.t ......................... ok t/dynpmc/md5.t ......................... ok t/dynpmc/pair.t ........................ ok t/dynpmc/rational.t .................... ok t/dynpmc/ripemd160.t ................... ok t/dynpmc/rotest.t ...................... ok t/dynpmc/sha.t ......................... ok t/dynpmc/sha1.t ........................ ok t/dynpmc/sha256.t ...................... ok t/dynpmc/sha512.t ...................... ok t/dynpmc/subclass_with_pir_method.t .... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy.t .................... ok t/dynoplibs/dan.t ...................... ok t/dynoplibs/myops.t .................... ok t/compilers/pct/complete_workflow.t .... ok t/compilers/pct/past.t ................. ok t/compilers/pct/pct_hllcompiler.t ...... ok t/compilers/pct/post.t ................. ok t/compilers/pge/00-basic.t ............. ok t/compilers/pge/02-match.t ............. ok t/compilers/pge/03-optable.t ........... ok t/compilers/pge/04-compile.t ........... ok t/compilers/pge/06-grammar.t ........... ok t/compilers/pge/pge-hs.t ............... ok t/compilers/pge/pge.t .................. ok t/compilers/pge/pge_examples.t ......... ok t/compilers/pge/pge_globs.t ............ ok t/compilers/pge/pge_text.t ............. ok t/compilers/pge/pge_util.t ............. ok t/compilers/pge/p5regex/p5rx.t ......... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.t .. not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context.t ... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic.t ................ ok t/compilers/tge/grammar.t .............. not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.t ............... ok t/library/cgi_query_hash.t ............. ok t/library/coroutine.t .................. ok t/library/dumper.t ..................... ok t/library/getopt_obj.t ................. ok t/library/hllmacros.t .................. ok t/library/iter.t ....................... ok t/library/md5.t ........................ ok t/library/mime_base64.t ................ ok t/library/mt19937ar.t .................. ok t/library/p6object.t ................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib.t .................. ok t/library/pcre.t ....................... ok 1 # SKIP no pcre-config ok t/library/pg.t ......................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject.t ................ ok t/library/rand.t ....................... ok t/library/range.t ...................... ok t/library/streams.t .................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.t ............... ok t/library/tcl_glob.t ................... ok t/library/tcl_lib.t .................... ok t/library/test_builder_tester.t ........ ok t/library/test_class.t ................. ok t/library/test_more.t .................. ok t/library/uuid.t ....................... ok t/library/yaml_dumper.t ................ not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck.t ........... not ok 1 - basic parsing # TODO Not properly implemented yet ok All tests successful. Files=255, Tests=8456, 447 wallclock secs ( 3.33 usr 0.71 sys + 145.59 cusr 38.23 csys = 187.86 CPU) Result: PASS /usr/bin/perl t/harness --gc-debug --running-make-test -C --runcore-tests t/compilers/imcc/imcpasm/cfg.t ......... ok t/compilers/imcc/imcpasm/opt0.t ........ ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.t ........ ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.t ........ ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.t ........ not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc.t ......... ok t/compilers/imcc/imcpasm/sub.t ......... ok t/compilers/imcc/reg/alloc.t ........... ok t/compilers/imcc/reg/spill.t ........... ok t/compilers/imcc/syn/bsr.t ............. ok t/compilers/imcc/syn/clash.t ........... not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.t ........... ok t/compilers/imcc/syn/errors.t .......... ok t/compilers/imcc/syn/eval.t ............ ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.t ............ ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll.t ............. ok t/compilers/imcc/syn/keyed.t ........... ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels.t .......... ok t/compilers/imcc/syn/macro.t ........... ok t/compilers/imcc/syn/objects.t ......... ok t/compilers/imcc/syn/op.t .............. ok t/compilers/imcc/syn/pasm.t ............ ok t/compilers/imcc/syn/pcc.t ............. ok t/compilers/imcc/syn/pod.t ............. ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions.t ..... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.t ........... ok t/compilers/imcc/syn/subflags.t ........ not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols.t ......... ok t/compilers/imcc/syn/tail.t ............ ok t/compilers/imcc/syn/veracity.t ........ ok t/op/00ff-dos.t ........................ ok t/op/00ff-unix.t ....................... ok t/op/01-parse_ops.t .................... ok t/op/64bit.t ........................... skipped: 64bit INTVAL platforms only t/op/annotate.t ........................ ok t/op/arithmetics.t ..................... ok t/op/basic.t ........................... ok t/op/bitwise.t ......................... ok t/op/box.t ............................. ok t/op/calling.t ......................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.t ....................... ok t/op/cc_state.t ........................ not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.t ................... ok t/op/comp.t ............................ ok t/op/copy.t ............................ ok t/op/debuginfo.t ....................... ok t/op/exceptions.t ...................... not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc.t .............................. ok t/op/globals.t ......................... ok t/op/hacks.t ........................... ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless.t ........................ ok t/op/integer.t ......................... ok t/op/interp.t .......................... ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io.t .............................. ok t/op/jit.t ............................. ok t/op/jitn.t ............................ ok t/op/lexicals.t ........................ not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal.t ......................... ok t/op/load_bytecode.t ................... ok t/op/number.t .......................... ok t/op/pushaction.t ...................... not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say.t ............................. ok t/op/spawnw.t .......................... ok t/op/sprintf.t ......................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2.t ........................ ok t/op/string.t .......................... ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass.t ................... ok t/op/string_cs.t ....................... ok t/op/string_mem.t ...................... ok t/op/stringu.t ......................... ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo.t ......................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok t/op/time.t ............................ ok t/op/trans.t ........................... ok t/pmc/addrregistry.t ................... ok t/pmc/array.t .......................... not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint.t ......................... ok t/pmc/bignum.t ......................... not ok 4 - set double, get str # TODO bignum strings not ok 5 - add # TODO bignum strings not ok 6 - add_int # TODO bignum strings not ok 10 - mul # TODO bignum strings not ok 11 - mul_float # TODO bignum strings not ok 16 - bignum / by zero BigInt # TODO missing signature not ok 18 - bignum % by zero BigNum # TODO missing signature not ok 19 - bignum % by zero BigInt # TODO missing signature not ok 20 - bignum % by zero Integer # TODO missing signature not ok 23 - abs # TODO bignum strings ok t/pmc/boolean.t ........................ ok t/pmc/bound_nci.t ...................... ok t/pmc/callsignature.t .................. ok t/pmc/capture.t ........................ ok t/pmc/class.t .......................... not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.t ..................... ok t/pmc/complex.t ........................ ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config.t ......................... ok t/pmc/continuation.t ................... ok t/pmc/coroutine.t ...................... not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.t ....................... ok t/pmc/default.t ........................ not ok 1 - new # TODO not implemeted ok t/pmc/env.t ............................ ok t/pmc/eval.t ........................... ok t/pmc/eventhandler.t ................... ok t/pmc/exception.t ...................... not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow ok 30 # SKIP intermittent segfault, RT #60556 ok t/pmc/exceptionhandler.t ............... ok t/pmc/exporter.t ....................... ok t/pmc/file.t ........................... ok t/pmc/filehandle.t ..................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray.t .............. ok t/pmc/fixedfloatarray.t ................ ok t/pmc/fixedintegerarray.t .............. ok t/pmc/fixedpmcarray.t .................. ok t/pmc/fixedstringarray.t ............... ok t/pmc/float.t .......................... ok t/pmc/freeze.t ......................... ok t/pmc/globals.t ........................ ok t/pmc/hash.t ........................... ok t/pmc/integer.t ........................ ok t/pmc/io.t ............................. not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet ok 23 # SKIP segfault, see TT #418 not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator.t .................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status.t ...................... not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator.t ....................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.t ............................ not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo.t ........................ ok t/pmc/lexpad.t ......................... ok t/pmc/managedstruct.t .................. ok t/pmc/multidispatch.t .................. not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.t ....................... ok t/pmc/namespace.t ...................... not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci.t ............................ ok t/pmc/null.t ........................... ok t/pmc/object-meths.t ................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.t ..................... ok t/pmc/object.t ......................... ok t/pmc/objects.t ........................ ok t/pmc/orderedhash.t .................... ok t/pmc/os.t ............................. ok t/pmc/packfile.t ....................... ok t/pmc/packfileannotation.t ............. ok t/pmc/packfileannotationkeys.t ......... ok t/pmc/packfileannotations.t ............ ok t/pmc/packfileconstanttable.t .......... not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory.t .............. ok t/pmc/packfilefixupentry.t ............. ok t/pmc/packfilefixuptable.t ............. ok t/pmc/packfilerawsegment.t ............. ok t/pmc/packfilesegment.t ................ ok t/pmc/parrotclass.t .................... ok t/pmc/parrotinterpreter.t .............. ok t/pmc/parrotio.t ....................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary.t .................. ok t/pmc/parrotobject.t ................... ok t/pmc/parrotrunningthread.t ............ ok t/pmc/parrotthread.t ................... ok t/pmc/pccmethod_test.t ................. ok t/pmc/pmc.t ............................ ok t/pmc/pmcproxy.t ....................... ok t/pmc/pointer.t ........................ ok t/pmc/prop.t ........................... ok t/pmc/random.t ......................... ok t/pmc/ref.t ............................ ok t/pmc/resizablebooleanarray.t .......... ok t/pmc/resizablefloatarray.t ............ ok t/pmc/resizableintegerarray.t .......... ok t/pmc/resizablepmcarray.t .............. ok t/pmc/resizablestringarray.t ........... ok t/pmc/retcontinuation.t ................ ok t/pmc/ro.t ............................. not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.t ........................... ok t/pmc/scalar.t ......................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler.t ...................... ok t/pmc/schedulermessage.t ............... ok t/pmc/sharedref.t ...................... ok t/pmc/signal.t ......................... skipped: Signals currently disabled t/pmc/slice.t .......................... not ok 2 - bug with slice bits # TODO parser ok t/pmc/string.t ......................... ok t/pmc/stringhandle.t ................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub.t ............................ ok t/pmc/sys.t ............................ ok t/pmc/task.t ........................... ok t/pmc/threads.t ........................ not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 14 - globals + constant table subs issue # TODO Broken with CGP not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer.t .......................... ok t/pmc/undef.t .......................... ok t/pmc/unmanagedstruct.t ................ ok t/oo/attributes.t ...................... ok t/oo/composition.t ..................... ok t/oo/inheritance.t ..................... ok t/oo/isa.t ............................. ok t/oo/metamodel.t ....................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods.t ......................... ok t/oo/mro-c3.t .......................... ok t/oo/names.t ........................... ok t/oo/new.t ............................. ok t/oo/ops.t ............................. ok t/oo/proxy.t ........................... ok t/oo/subclass.t ........................ ok t/oo/vtableoverride.t .................. ok t/native_pbc/header.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/integer.t ................. skipped: pending robust testing strategy, TT #357 t/native_pbc/number.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/string.t .................. skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad.t ................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo.t ......................... ok t/dynpmc/gdbmhash.t .................... ok t/dynpmc/md2.t ......................... ok t/dynpmc/md4.t ......................... ok t/dynpmc/md5.t ......................... ok t/dynpmc/pair.t ........................ ok t/dynpmc/rational.t .................... ok t/dynpmc/ripemd160.t ................... ok t/dynpmc/rotest.t ...................... ok t/dynpmc/sha.t ......................... ok t/dynpmc/sha1.t ........................ ok t/dynpmc/sha256.t ...................... ok t/dynpmc/sha512.t ...................... ok t/dynpmc/subclass_with_pir_method.t .... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy.t .................... ok t/dynoplibs/dan.t ...................... ok t/dynoplibs/myops.t .................... ok t/compilers/pct/complete_workflow.t .... ok t/compilers/pct/past.t ................. ok t/compilers/pct/pct_hllcompiler.t ...... ok t/compilers/pct/post.t ................. ok t/compilers/pge/00-basic.t ............. ok t/compilers/pge/02-match.t ............. ok t/compilers/pge/03-optable.t ........... ok t/compilers/pge/04-compile.t ........... ok t/compilers/pge/06-grammar.t ........... ok t/compilers/pge/pge-hs.t ............... ok t/compilers/pge/pge.t .................. ok t/compilers/pge/pge_examples.t ......... ok t/compilers/pge/pge_globs.t ............ ok t/compilers/pge/pge_text.t ............. ok t/compilers/pge/pge_util.t ............. ok t/compilers/pge/p5regex/p5rx.t ......... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.t .. not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context.t ... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic.t ................ ok t/compilers/tge/grammar.t .............. not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.t ............... ok t/library/cgi_query_hash.t ............. ok t/library/coroutine.t .................. ok t/library/dumper.t ..................... ok t/library/getopt_obj.t ................. ok t/library/hllmacros.t .................. ok t/library/iter.t ....................... ok t/library/md5.t ........................ ok t/library/mime_base64.t ................ ok t/library/mt19937ar.t .................. ok t/library/p6object.t ................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib.t .................. ok t/library/pcre.t ....................... ok 1 # SKIP no pcre-config ok t/library/pg.t ......................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject.t ................ ok t/library/rand.t ....................... ok t/library/range.t ...................... ok t/library/streams.t .................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.t ............... ok t/library/tcl_glob.t ................... ok t/library/tcl_lib.t .................... ok t/library/test_builder_tester.t ........ ok t/library/test_class.t ................. ok t/library/test_more.t .................. ok t/library/uuid.t ....................... ok t/library/yaml_dumper.t ................ not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck.t ........... not ok 1 - basic parsing # TODO Not properly implemented yet ok All tests successful. Files=255, Tests=8456, 458 wallclock secs ( 3.35 usr 0.69 sys + 146.31 cusr 39.03 csys = 189.38 CPU) Result: PASS /usr/bin/perl t/harness --gc-debug --running-make-test -f --runcore-tests t/compilers/imcc/imcpasm/cfg.t ......... ok t/compilers/imcc/imcpasm/opt0.t ........ ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.t ........ ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.t ........ ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.t ........ not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc.t ......... ok t/compilers/imcc/imcpasm/sub.t ......... ok t/compilers/imcc/reg/alloc.t ........... ok t/compilers/imcc/reg/spill.t ........... ok t/compilers/imcc/syn/bsr.t ............. ok t/compilers/imcc/syn/clash.t ........... not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.t ........... ok t/compilers/imcc/syn/errors.t .......... ok t/compilers/imcc/syn/eval.t ............ ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.t ............ ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll.t ............. ok t/compilers/imcc/syn/keyed.t ........... ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels.t .......... ok t/compilers/imcc/syn/macro.t ........... ok t/compilers/imcc/syn/objects.t ......... ok t/compilers/imcc/syn/op.t .............. ok t/compilers/imcc/syn/pasm.t ............ ok t/compilers/imcc/syn/pcc.t ............. ok t/compilers/imcc/syn/pod.t ............. ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions.t ..... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.t ........... ok t/compilers/imcc/syn/subflags.t ........ not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols.t ......... ok t/compilers/imcc/syn/tail.t ............ ok t/compilers/imcc/syn/veracity.t ........ ok t/op/00ff-dos.t ........................ ok t/op/00ff-unix.t ....................... ok t/op/01-parse_ops.t .................... ok t/op/64bit.t ........................... skipped: 64bit INTVAL platforms only t/op/annotate.t ........................ ok t/op/arithmetics.t ..................... ok t/op/basic.t ........................... ok t/op/bitwise.t ......................... ok t/op/box.t ............................. ok t/op/calling.t ......................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.t ....................... ok t/op/cc_state.t ........................ not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.t ................... ok t/op/comp.t ............................ ok t/op/copy.t ............................ ok t/op/debuginfo.t ....................... ok 1 # SKIP disabled on fast-core ok 7 # SKIP disabled on this core ok 8 # SKIP disabled on this core ok t/op/exceptions.t ...................... not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc.t .............................. ok t/op/globals.t ......................... ok t/op/hacks.t ........................... ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless.t ........................ ok t/op/integer.t ......................... ok t/op/interp.t .......................... ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io.t .............................. ok t/op/jit.t ............................. ok t/op/jitn.t ............................ ok t/op/lexicals.t ........................ not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal.t ......................... ok t/op/load_bytecode.t ................... ok t/op/number.t .......................... ok t/op/pushaction.t ...................... not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say.t ............................. ok t/op/spawnw.t .......................... ok t/op/sprintf.t ......................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2.t ........................ ok t/op/string.t .......................... ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass.t ................... ok t/op/string_cs.t ....................... ok t/op/string_mem.t ...................... ok t/op/stringu.t ......................... ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo.t ......................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok t/op/time.t ............................ ok t/op/trans.t ........................... ok t/pmc/addrregistry.t ................... ok t/pmc/array.t .......................... not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint.t ......................... ok t/pmc/bignum.t ......................... not ok 4 - set double, get str # TODO bignum strings not ok 5 - add # TODO bignum strings not ok 6 - add_int # TODO bignum strings not ok 10 - mul # TODO bignum strings not ok 11 - mul_float # TODO bignum strings not ok 16 - bignum / by zero BigInt # TODO missing signature not ok 18 - bignum % by zero BigNum # TODO missing signature not ok 19 - bignum % by zero BigInt # TODO missing signature not ok 20 - bignum % by zero Integer # TODO missing signature not ok 23 - abs # TODO bignum strings ok t/pmc/boolean.t ........................ ok t/pmc/bound_nci.t ...................... ok t/pmc/callsignature.t .................. ok t/pmc/capture.t ........................ ok t/pmc/class.t .......................... not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.t ..................... ok t/pmc/complex.t ........................ ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config.t ......................... ok t/pmc/continuation.t ................... ok t/pmc/coroutine.t ...................... not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.t ....................... ok t/pmc/default.t ........................ not ok 1 - new # TODO not implemeted ok t/pmc/env.t ............................ ok t/pmc/eval.t ........................... ok t/pmc/eventhandler.t ................... ok t/pmc/exception.t ...................... not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow ok 30 # SKIP intermittent segfault, RT #60556 ok t/pmc/exceptionhandler.t ............... ok t/pmc/exporter.t ....................... ok t/pmc/file.t ........................... ok t/pmc/filehandle.t ..................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray.t .............. ok t/pmc/fixedfloatarray.t ................ ok t/pmc/fixedintegerarray.t .............. ok t/pmc/fixedpmcarray.t .................. ok t/pmc/fixedstringarray.t ............... ok t/pmc/float.t .......................... ok t/pmc/freeze.t ......................... ok t/pmc/globals.t ........................ ok t/pmc/hash.t ........................... ok t/pmc/integer.t ........................ ok t/pmc/io.t ............................. not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet ok 23 # SKIP segfault, see TT #418 not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator.t .................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status.t ...................... not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator.t ....................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.t ............................ not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo.t ........................ ok t/pmc/lexpad.t ......................... ok t/pmc/managedstruct.t .................. ok t/pmc/multidispatch.t .................. not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.t ....................... ok t/pmc/namespace.t ...................... not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci.t ............................ ok t/pmc/null.t ........................... ok t/pmc/object-meths.t ................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.t ..................... ok t/pmc/object.t ......................... ok t/pmc/objects.t ........................ ok t/pmc/orderedhash.t .................... ok t/pmc/os.t ............................. ok t/pmc/packfile.t ....................... ok t/pmc/packfileannotation.t ............. ok t/pmc/packfileannotationkeys.t ......... ok t/pmc/packfileannotations.t ............ ok t/pmc/packfileconstanttable.t .......... not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory.t .............. ok t/pmc/packfilefixupentry.t ............. ok t/pmc/packfilefixuptable.t ............. ok t/pmc/packfilerawsegment.t ............. ok t/pmc/packfilesegment.t ................ ok t/pmc/parrotclass.t .................... ok t/pmc/parrotinterpreter.t .............. ok t/pmc/parrotio.t ....................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary.t .................. ok t/pmc/parrotobject.t ................... ok t/pmc/parrotrunningthread.t ............ ok t/pmc/parrotthread.t ................... ok t/pmc/pccmethod_test.t ................. ok t/pmc/pmc.t ............................ ok t/pmc/pmcproxy.t ....................... ok t/pmc/pointer.t ........................ ok t/pmc/prop.t ........................... ok t/pmc/random.t ......................... ok t/pmc/ref.t ............................ ok t/pmc/resizablebooleanarray.t .......... ok t/pmc/resizablefloatarray.t ............ ok t/pmc/resizableintegerarray.t .......... ok t/pmc/resizablepmcarray.t .............. ok t/pmc/resizablestringarray.t ........... ok t/pmc/retcontinuation.t ................ ok t/pmc/ro.t ............................. not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.t ........................... ok t/pmc/scalar.t ......................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler.t ...................... ok t/pmc/schedulermessage.t ............... ok t/pmc/sharedref.t ...................... ok t/pmc/signal.t ......................... skipped: Signals currently disabled t/pmc/slice.t .......................... not ok 2 - bug with slice bits # TODO parser ok t/pmc/string.t ......................... ok t/pmc/stringhandle.t ................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub.t ............................ ok t/pmc/sys.t ............................ ok t/pmc/task.t ........................... ok t/pmc/threads.t ........................ not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer.t .......................... ok t/pmc/undef.t .......................... ok t/pmc/unmanagedstruct.t ................ ok t/oo/attributes.t ...................... ok t/oo/composition.t ..................... ok t/oo/inheritance.t ..................... ok t/oo/isa.t ............................. ok t/oo/metamodel.t ....................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods.t ......................... ok t/oo/mro-c3.t .......................... ok t/oo/names.t ........................... ok t/oo/new.t ............................. ok t/oo/ops.t ............................. ok t/oo/proxy.t ........................... ok t/oo/subclass.t ........................ ok t/oo/vtableoverride.t .................. ok t/native_pbc/header.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/integer.t ................. skipped: pending robust testing strategy, TT #357 t/native_pbc/number.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/string.t .................. skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad.t ................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo.t ......................... ok t/dynpmc/gdbmhash.t .................... ok t/dynpmc/md2.t ......................... ok t/dynpmc/md4.t ......................... ok t/dynpmc/md5.t ......................... ok t/dynpmc/pair.t ........................ ok t/dynpmc/rational.t .................... ok t/dynpmc/ripemd160.t ................... ok t/dynpmc/rotest.t ...................... ok t/dynpmc/sha.t ......................... ok t/dynpmc/sha1.t ........................ ok t/dynpmc/sha256.t ...................... ok t/dynpmc/sha512.t ...................... ok t/dynpmc/subclass_with_pir_method.t .... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy.t .................... ok t/dynoplibs/dan.t ...................... ok t/dynoplibs/myops.t .................... ok t/compilers/pct/complete_workflow.t .... ok t/compilers/pct/past.t ................. ok t/compilers/pct/pct_hllcompiler.t ...... ok t/compilers/pct/post.t ................. ok t/compilers/pge/00-basic.t ............. ok t/compilers/pge/02-match.t ............. ok t/compilers/pge/03-optable.t ........... ok t/compilers/pge/04-compile.t ........... ok t/compilers/pge/06-grammar.t ........... ok t/compilers/pge/pge-hs.t ............... ok t/compilers/pge/pge.t .................. ok t/compilers/pge/pge_examples.t ......... ok t/compilers/pge/pge_globs.t ............ ok t/compilers/pge/pge_text.t ............. ok t/compilers/pge/pge_util.t ............. ok t/compilers/pge/p5regex/p5rx.t ......... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.t .. not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context.t ... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic.t ................ ok t/compilers/tge/grammar.t .............. not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.t ............... ok t/library/cgi_query_hash.t ............. ok t/library/coroutine.t .................. ok t/library/dumper.t ..................... ok t/library/getopt_obj.t ................. ok t/library/hllmacros.t .................. ok t/library/iter.t ....................... ok t/library/md5.t ........................ ok t/library/mime_base64.t ................ ok t/library/mt19937ar.t .................. ok t/library/p6object.t ................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib.t .................. ok t/library/pcre.t ....................... ok 1 # SKIP no pcre-config ok t/library/pg.t ......................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject.t ................ ok t/library/rand.t ....................... ok t/library/range.t ...................... ok t/library/streams.t .................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.t ............... ok t/library/tcl_glob.t ................... ok t/library/tcl_lib.t .................... ok t/library/test_builder_tester.t ........ ok t/library/test_class.t ................. ok t/library/test_more.t .................. ok t/library/uuid.t ....................... ok t/library/yaml_dumper.t ................ not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck.t ........... not ok 1 - basic parsing # TODO Not properly implemented yet ok All tests successful. Files=255, Tests=8456, 440 wallclock secs ( 3.49 usr 0.69 sys + 145.87 cusr 38.61 csys = 188.66 CPU) Result: PASS /usr/bin/perl t/harness --gc-debug --running-make-test -g --runcore-tests t/compilers/imcc/imcpasm/cfg.t ......... ok t/compilers/imcc/imcpasm/opt0.t ........ ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.t ........ ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.t ........ ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.t ........ not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc.t ......... ok t/compilers/imcc/imcpasm/sub.t ......... ok t/compilers/imcc/reg/alloc.t ........... ok t/compilers/imcc/reg/spill.t ........... ok t/compilers/imcc/syn/bsr.t ............. ok t/compilers/imcc/syn/clash.t ........... not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.t ........... ok t/compilers/imcc/syn/errors.t .......... ok t/compilers/imcc/syn/eval.t ............ ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.t ............ ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll.t ............. ok t/compilers/imcc/syn/keyed.t ........... ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels.t .......... ok t/compilers/imcc/syn/macro.t ........... ok t/compilers/imcc/syn/objects.t ......... ok t/compilers/imcc/syn/op.t .............. ok t/compilers/imcc/syn/pasm.t ............ ok t/compilers/imcc/syn/pcc.t ............. ok t/compilers/imcc/syn/pod.t ............. ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions.t ..... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.t ........... ok t/compilers/imcc/syn/subflags.t ........ not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols.t ......... ok t/compilers/imcc/syn/tail.t ............ ok t/compilers/imcc/syn/veracity.t ........ ok t/op/00ff-dos.t ........................ ok t/op/00ff-unix.t ....................... ok t/op/01-parse_ops.t .................... ok t/op/64bit.t ........................... skipped: 64bit INTVAL platforms only t/op/annotate.t ........................ ok t/op/arithmetics.t ..................... ok t/op/basic.t ........................... ok t/op/bitwise.t ......................... ok t/op/box.t ............................. ok t/op/calling.t ......................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.t ....................... ok t/op/cc_state.t ........................ not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.t ................... ok t/op/comp.t ............................ ok t/op/copy.t ............................ ok t/op/debuginfo.t ....................... ok 1 # SKIP disabled on fast-core ok 7 # SKIP disabled on this core ok 8 # SKIP disabled on this core ok t/op/exceptions.t ...................... not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc.t .............................. ok t/op/globals.t ......................... ok t/op/hacks.t ........................... ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless.t ........................ ok t/op/integer.t ......................... ok t/op/interp.t .......................... ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io.t .............................. ok t/op/jit.t ............................. ok t/op/jitn.t ............................ ok t/op/lexicals.t ........................ not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal.t ......................... ok t/op/load_bytecode.t ................... ok t/op/number.t .......................... ok t/op/pushaction.t ...................... not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say.t ............................. ok t/op/spawnw.t .......................... ok t/op/sprintf.t ......................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2.t ........................ ok t/op/string.t .......................... ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass.t ................... ok t/op/string_cs.t ....................... ok t/op/string_mem.t ...................... ok t/op/stringu.t ......................... ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo.t ......................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok t/op/time.t ............................ ok t/op/trans.t ........................... ok t/pmc/addrregistry.t ................... ok t/pmc/array.t .......................... not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint.t ......................... ok t/pmc/bignum.t ......................... not ok 4 - set double, get str # TODO bignum strings not ok 5 - add # TODO bignum strings not ok 6 - add_int # TODO bignum strings not ok 10 - mul # TODO bignum strings not ok 11 - mul_float # TODO bignum strings not ok 16 - bignum / by zero BigInt # TODO missing signature not ok 18 - bignum % by zero BigNum # TODO missing signature not ok 19 - bignum % by zero BigInt # TODO missing signature not ok 20 - bignum % by zero Integer # TODO missing signature not ok 23 - abs # TODO bignum strings ok t/pmc/boolean.t ........................ ok t/pmc/bound_nci.t ...................... ok t/pmc/callsignature.t .................. ok t/pmc/capture.t ........................ ok t/pmc/class.t .......................... not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.t ..................... ok t/pmc/complex.t ........................ ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config.t ......................... ok t/pmc/continuation.t ................... ok t/pmc/coroutine.t ...................... not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.t ....................... ok t/pmc/default.t ........................ not ok 1 - new # TODO not implemeted ok t/pmc/env.t ............................ ok t/pmc/eval.t ........................... ok t/pmc/eventhandler.t ................... ok t/pmc/exception.t ...................... not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow ok 30 # SKIP intermittent segfault, RT #60556 ok t/pmc/exceptionhandler.t ............... ok t/pmc/exporter.t ....................... ok t/pmc/file.t ........................... ok t/pmc/filehandle.t ..................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray.t .............. ok t/pmc/fixedfloatarray.t ................ ok t/pmc/fixedintegerarray.t .............. ok t/pmc/fixedpmcarray.t .................. ok t/pmc/fixedstringarray.t ............... ok t/pmc/float.t .......................... ok t/pmc/freeze.t ......................... ok t/pmc/globals.t ........................ ok t/pmc/hash.t ........................... ok t/pmc/integer.t ........................ ok t/pmc/io.t ............................. not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet ok 23 # SKIP segfault, see TT #418 not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator.t .................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status.t ...................... not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator.t ....................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.t ............................ not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo.t ........................ ok t/pmc/lexpad.t ......................... ok t/pmc/managedstruct.t .................. ok t/pmc/multidispatch.t .................. not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.t ....................... ok t/pmc/namespace.t ...................... not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci.t ............................ ok t/pmc/null.t ........................... ok t/pmc/object-meths.t ................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.t ..................... ok t/pmc/object.t ......................... ok t/pmc/objects.t ........................ ok t/pmc/orderedhash.t .................... ok t/pmc/os.t ............................. ok t/pmc/packfile.t ....................... ok t/pmc/packfileannotation.t ............. ok t/pmc/packfileannotationkeys.t ......... ok t/pmc/packfileannotations.t ............ ok t/pmc/packfileconstanttable.t .......... not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory.t .............. ok t/pmc/packfilefixupentry.t ............. ok t/pmc/packfilefixuptable.t ............. ok t/pmc/packfilerawsegment.t ............. ok t/pmc/packfilesegment.t ................ ok t/pmc/parrotclass.t .................... ok t/pmc/parrotinterpreter.t .............. ok t/pmc/parrotio.t ....................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary.t .................. ok t/pmc/parrotobject.t ................... ok t/pmc/parrotrunningthread.t ............ ok t/pmc/parrotthread.t ................... ok t/pmc/pccmethod_test.t ................. ok t/pmc/pmc.t ............................ ok t/pmc/pmcproxy.t ....................... ok t/pmc/pointer.t ........................ ok t/pmc/prop.t ........................... ok t/pmc/random.t ......................... ok t/pmc/ref.t ............................ ok t/pmc/resizablebooleanarray.t .......... ok t/pmc/resizablefloatarray.t ............ ok t/pmc/resizableintegerarray.t .......... ok t/pmc/resizablepmcarray.t .............. ok t/pmc/resizablestringarray.t ........... ok t/pmc/retcontinuation.t ................ ok t/pmc/ro.t ............................. not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.t ........................... ok t/pmc/scalar.t ......................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler.t ...................... ok t/pmc/schedulermessage.t ............... ok t/pmc/sharedref.t ...................... ok t/pmc/signal.t ......................... skipped: Signals currently disabled t/pmc/slice.t .......................... not ok 2 - bug with slice bits # TODO parser ok t/pmc/string.t ......................... ok t/pmc/stringhandle.t ................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub.t ............................ ok t/pmc/sys.t ............................ ok t/pmc/task.t ........................... ok t/pmc/threads.t ........................ not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer.t .......................... ok t/pmc/undef.t .......................... ok t/pmc/unmanagedstruct.t ................ ok t/oo/attributes.t ...................... ok t/oo/composition.t ..................... ok t/oo/inheritance.t ..................... ok t/oo/isa.t ............................. ok t/oo/metamodel.t ....................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods.t ......................... ok t/oo/mro-c3.t .......................... ok t/oo/names.t ........................... ok t/oo/new.t ............................. ok t/oo/ops.t ............................. ok t/oo/proxy.t ........................... ok t/oo/subclass.t ........................ ok t/oo/vtableoverride.t .................. ok t/native_pbc/header.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/integer.t ................. skipped: pending robust testing strategy, TT #357 t/native_pbc/number.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/string.t .................. skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad.t ................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo.t ......................... ok t/dynpmc/gdbmhash.t .................... ok t/dynpmc/md2.t ......................... ok t/dynpmc/md4.t ......................... ok t/dynpmc/md5.t ......................... ok t/dynpmc/pair.t ........................ ok t/dynpmc/rational.t .................... ok t/dynpmc/ripemd160.t ................... ok t/dynpmc/rotest.t ...................... ok t/dynpmc/sha.t ......................... ok t/dynpmc/sha1.t ........................ ok t/dynpmc/sha256.t ...................... ok t/dynpmc/sha512.t ...................... ok t/dynpmc/subclass_with_pir_method.t .... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy.t .................... ok t/dynoplibs/dan.t ...................... ok t/dynoplibs/myops.t .................... ok 6 # SKIP dynops weird in CGP with events ok 7 # SKIP dynops weird in CGP with events ok t/compilers/pct/complete_workflow.t .... ok t/compilers/pct/past.t ................. ok t/compilers/pct/pct_hllcompiler.t ...... ok t/compilers/pct/post.t ................. ok t/compilers/pge/00-basic.t ............. ok t/compilers/pge/02-match.t ............. ok t/compilers/pge/03-optable.t ........... ok t/compilers/pge/04-compile.t ........... ok t/compilers/pge/06-grammar.t ........... ok t/compilers/pge/pge-hs.t ............... ok t/compilers/pge/pge.t .................. ok t/compilers/pge/pge_examples.t ......... ok t/compilers/pge/pge_globs.t ............ ok t/compilers/pge/pge_text.t ............. ok t/compilers/pge/pge_util.t ............. ok t/compilers/pge/p5regex/p5rx.t ......... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.t .. not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context.t ... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic.t ................ ok t/compilers/tge/grammar.t .............. not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.t ............... ok t/library/cgi_query_hash.t ............. ok t/library/coroutine.t .................. ok t/library/dumper.t ..................... ok t/library/getopt_obj.t ................. ok t/library/hllmacros.t .................. ok t/library/iter.t ....................... ok t/library/md5.t ........................ ok t/library/mime_base64.t ................ ok t/library/mt19937ar.t .................. ok t/library/p6object.t ................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib.t .................. ok t/library/pcre.t ....................... ok 1 # SKIP no pcre-config ok t/library/pg.t ......................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject.t ................ ok t/library/rand.t ....................... ok t/library/range.t ...................... ok t/library/streams.t .................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.t ............... ok t/library/tcl_glob.t ................... ok t/library/tcl_lib.t .................... ok t/library/test_builder_tester.t ........ ok t/library/test_class.t ................. ok t/library/test_more.t .................. ok t/library/uuid.t ....................... ok t/library/yaml_dumper.t ................ not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck.t ........... not ok 1 - basic parsing # TODO Not properly implemented yet ok All tests successful. Files=255, Tests=8456, 388 wallclock secs ( 3.31 usr 0.66 sys + 145.02 cusr 38.02 csys = 187.01 CPU) Result: PASS /usr/bin/perl t/harness --gc-debug --running-make-test -j --runcore-tests t/compilers/imcc/imcpasm/cfg.t ......... ok t/compilers/imcc/imcpasm/opt0.t ........ ok 1 # SKIP disabled graph coloring register allocator, RT #57028 ok 3 # SKIP disabled graph coloring register allocator, RT #57028 ok t/compilers/imcc/imcpasm/opt1.t ........ ok 76 # SKIP constant concat N/Y ok t/compilers/imcc/imcpasm/opt2.t ........ ok 5 # SKIP loop opt disabled for now ok t/compilers/imcc/imcpasm/optc.t ........ not ok 9 - tailcall 1 # TODO RT #57028 ok t/compilers/imcc/imcpasm/pcc.t ......... ok t/compilers/imcc/imcpasm/sub.t ......... ok t/compilers/imcc/reg/alloc.t ........... ok t/compilers/imcc/reg/spill.t ........... ok t/compilers/imcc/syn/bsr.t ............. ok t/compilers/imcc/syn/clash.t ........... not ok 9 - new with a native type, no string constant # TODO RT #51662 not done yet ok t/compilers/imcc/syn/const.t ........... ok t/compilers/imcc/syn/errors.t .......... ok t/compilers/imcc/syn/eval.t ............ ok 1 # SKIP changed eval semantics - see t/pmc/eval.t ok 2 # SKIP changed eval semantics - see t/pmc/eval.t ok 3 # SKIP changed eval semantics - see t/pmc/eval.t ok 4 # SKIP changed eval semantics - see t/pmc/eval.t ok 5 # SKIP changed eval semantics - see t/pmc/eval.t ok 6 # SKIP changed eval semantics - see t/pmc/eval.t ok 7 # SKIP changed eval semantics - see t/pmc/eval.t ok t/compilers/imcc/syn/file.t ............ ok 13 # SKIP multiple loading not speced - failing ok t/compilers/imcc/syn/hll.t ............. ok t/compilers/imcc/syn/keyed.t ........... ok 1 # SKIP experimental ok t/compilers/imcc/syn/labels.t .......... ok t/compilers/imcc/syn/macro.t ........... ok t/compilers/imcc/syn/objects.t ......... ok t/compilers/imcc/syn/op.t .............. ok t/compilers/imcc/syn/pasm.t ............ ok t/compilers/imcc/syn/pcc.t ............. ok t/compilers/imcc/syn/pod.t ............. ok 4 # SKIP Closing out of pod from included files ok t/compilers/imcc/syn/regressions.t ..... not ok 4 - comments between .param(RT \#46499) # TODO broken not ok 6 - whitespace between .param(RT \#46499) # TODO broken not ok 7 - off by one error message (RT \#40204) # TODO broken ok t/compilers/imcc/syn/scope.t ........... ok t/compilers/imcc/syn/subflags.t ........ not ok 15 # TODO :method sub not found in namespace ok t/compilers/imcc/syn/symbols.t ......... ok t/compilers/imcc/syn/tail.t ............ ok t/compilers/imcc/syn/veracity.t ........ ok t/op/00ff-dos.t ........................ ok t/op/00ff-unix.t ....................... ok t/op/01-parse_ops.t .................... skipped: IMCC cannot do parse-only with JIT enabled t/op/64bit.t ........................... skipped: 64bit INTVAL platforms only t/op/annotate.t ........................ ok t/op/arithmetics.t ..................... ok t/op/basic.t ........................... ok t/op/bitwise.t ......................... ok 27 - I-reg shl and PMC shl are consistent # TODO broken with JIT (RT #43245) ok t/op/box.t ............................. ok t/op/calling.t ......................... not ok 16 - argc mismatch, too many - no getparams # TODO no get_params at all not ok 93 - arg mismatch with no params # TODO RT #39844 ok t/op/cc_params.t ....................... ok t/op/cc_state.t ........................ not ok 6 - positional found, named expected # TODO cc processor state missing not ok 8 - G2: argument underflow: required slurpy param # TODO failing ok t/op/cmp-nonbranch.t ................... ok t/op/comp.t ............................ ok t/op/copy.t ............................ ok t/op/debuginfo.t ....................... ok 7 # SKIP disabled on this core ok 8 # SKIP disabled on this core ok t/op/exceptions.t ...................... not ok 21 - pop_eh out of context (2) # TODO runloop shenanigans ok t/op/gc.t .............................. ok t/op/globals.t ......................... ok t/op/hacks.t ........................... ok 1 # SKIP no universal SIGFPE handling ok 2 # SKIP no universal SIGFPE handling ok t/op/ifunless.t ........................ ok t/op/integer.t ......................... ok t/op/interp.t .......................... ok 1 # SKIP we really shouldn't run just a label - use a sub ok t/op/io.t .............................. ok t/op/jit.t ............................. ok t/op/jitn.t ............................ ok t/op/lexicals.t ........................ not ok 42 - find_lex: (Perl6 OUTER::) # TODO not yet implemented ok t/op/literal.t ......................... ok t/op/load_bytecode.t ................... ok t/op/number.t .......................... ok t/op/pushaction.t ...................... not ok 7 - pushaction: error while handling error # TODO runloop shenanigans ok t/op/say.t ............................. ok t/op/spawnw.t .......................... ok t/op/sprintf.t ......................... ok 5 # SKIP parrot extension (%B) ok 7 # SKIP perl5-specific extension (%D) ok 9 # SKIP perl5-specific extension (%F) ok 16 # SKIP parrot extension (%H) ok 20 # SKIP parrot extension (%L) ok 23 # SKIP perl5-specific extension (%O) ok 24 # SKIP parrot extension (%P) ok 27 # SKIP parrot extension (%S) ok 29 # SKIP perl5-specific extension (%U) not ok 64 # TODO [%03.2d] actual: > 01< ok 71 # SKIP perl5-specific extension (%v...) ok 72 # SKIP perl5-specific extension (%v...) ok 73 # SKIP perl5-specific extension (%v...) ok 74 # SKIP perl5-specific extension (%v...) ok 75 # SKIP perl5-specific extension (%v...) ok 76 # SKIP perl5-specific extension (%v...) ok 77 # SKIP perl5-specific extension (%v...) ok 78 # SKIP perl5-specific extension (%v...) ok 79 # SKIP perl5-specific extension (%v...) ok 80 # SKIP perl5-specific extension (%v...) ok 81 # SKIP perl5-specific extension (%v...) ok 82 # SKIP perl5-specific extension (%v...) ok 83 # SKIP perl5-specific extension (%v...) ok 84 # SKIP perl5-specific extension (%v...) ok 85 # SKIP perl5-specific extension (%v...) ok 86 # SKIP perl5-specific extension (%v...) ok 87 # SKIP perl5-specific extension (%v...) ok 88 # SKIP perl5-specific extension (%v...) ok 89 # SKIP perl5-specific extension (%v...) ok 90 # SKIP perl5-specific extension (%v...) ok 91 # SKIP perl5-specific extension (%v...) ok 92 # SKIP perl5-specific extension (%v...) ok 93 # SKIP perl5-specific extension (%v...) ok 94 # SKIP perl5-specific extension (%v...) ok 95 # SKIP perl5-specific extension (%v...) ok 96 # SKIP perl5-specific extension (%v...) ok 97 # SKIP perl5-specific extension (%v...) ok 98 # SKIP perl5-specific extension (%v...) ok 99 # SKIP perl5-specific extension (%v...) ok 114 # SKIP harness needs support for * modifier ok 131 # SKIP harness needs support for * modifier ok 141 # SKIP harness needs support for * modifier ok 144 # SKIP perl5 expresssion as test value not ok 153 # TODO [%.0hf] 'h' should be rejected (skipped on this platform) actual: >1< ok 161 # SKIP harness needs support for * modifier ok 166 # SKIP harness needs support for * modifier not ok 187 # TODO [%h] actual: >< not ok 191 # TODO [%l] actual: >< ok 193 # SKIP perl5-specific test ok 200 # SKIP perl5-specific test ok 201 # SKIP perl5-specific test ok 202 # SKIP parrot extension (%p) ok 204 # SKIP parrot extension (%r) ok 210 # SKIP harness needs support for * modifier ok 214 # SKIP harness needs support for * modifier not ok 223 # TODO [%v] actual: >< ok 233 # SKIP harness needs support for * modifier ok 234 # SKIP perl5-specific extension (%v...) ok 235 # SKIP perl5-specific extension (%v...) ok 238 # SKIP perl5-specific test ok 239 # SKIP perl5-specific test ok 240 # SKIP perl5-specific test ok 241 # SKIP perl5-specific test ok 242 # SKIP perl5-specific test ok 243 # SKIP perl5-specific test ok 244 # SKIP perl5-specific test ok 245 # SKIP perl5-specific test ok 246 # SKIP perl5-specific test ok 247 # SKIP perl5-specific test ok 248 # SKIP perl5-specific test ok 249 # SKIP perl5-specific test ok 250 # SKIP perl5-specific test ok 251 # SKIP perl5-specific test ok 252 # SKIP perl5-specific extension (%v...) ok 253 # SKIP perl5-specific extension (%v...) ok 254 # SKIP perl5-specific extension (%v...) ok 255 # SKIP perl5-specific extension (%v...) ok 256 # SKIP perl5-specific extension (%v...) ok 257 # SKIP perl5-specific extension (%v...) ok 258 # SKIP perl5-specific extension (%v...) ok 259 # SKIP perl5-specific extension (%v...) ok 260 # SKIP perl5-specific extension (%v...) ok 261 # SKIP perl5-specific extension (%v...) ok 262 # SKIP perl5-specific extension (%v...) ok 263 # SKIP perl5-specific extension (%v...) ok 264 # SKIP perl5-specific extension (%v...) ok 265 # SKIP perl5-specific extension (%v...) ok 266 # SKIP perl5-specific extension (%v...) ok 267 # SKIP perl5-specific extension (%v...) ok 268 # SKIP perl5-specific extension (%v...) ok 269 # SKIP perl5-specific extension (%v...) ok 270 # SKIP perl5-specific extension (%v...) ok 271 # SKIP perl5-specific extension (%v...) ok 272 # SKIP perl5-specific extension (%v...) ok 273 # SKIP perl5-specific extension (%v...) ok 274 # SKIP perl5-specific extension (%v...) ok 275 # SKIP perl5-specific extension (%v...) ok 276 # SKIP perl5-specific extension (%v...) ok 277 # SKIP perl5-specific extension (%v...) ok 278 # SKIP perl5-specific extension (%v...) ok 279 # SKIP perl5-specific extension (%v...) ok 280 # SKIP perl5-specific extension (%v...) ok 281 # SKIP perl5-specific extension (%v...) ok 282 # SKIP perl5-specific extension (%v...) ok 283 # SKIP perl5-specific extension (%v...) ok 284 # SKIP perl5-specific extension (%v...) ok 285 # SKIP perl5-specific extension (%v...) ok 286 # SKIP perl5-specific extension (%v...) ok 287 # SKIP perl5-specific extension (%v...) ok 288 # SKIP perl5-specific extension (%v...) ok 289 # SKIP perl5-specific extension (%v...) ok 290 # SKIP perl5-specific extension (%v...) ok 291 # SKIP perl5-specific extension (%v...) ok 292 # SKIP perl5-specific extension (%v...) ok 293 # SKIP perl5-specific extension (%v...) ok 294 # SKIP perl5-specific extension (%v...) ok 295 # SKIP perl5-specific extension (%v...) ok 296 # SKIP perl5-specific extension (%v...) ok 297 # SKIP perl5-specific extension (%v...) ok 298 # SKIP perl5-specific extension (%v...) ok 300 # SKIP harness needs support for * modifier not ok 304 # TODO [%#b] actual: >0b0< not ok 305 # TODO [%#o] actual: >00< not ok 306 # TODO [%#x] actual: >0x0< ok 307 # SKIP perl5-specific extension (%v...) ok 308 # SKIP perl5-specific extension (%v...) ok t/op/sprintf2.t ........................ ok t/op/string.t .......................... ok 103 # SKIP Pending rework of creating non-ascii literals ok 104 # SKIP Pending rework of creating non-ascii literals ok 118 # SKIP Pending reimplementation of find_encoding ok 119 # SKIP no more visible encoding ok 137 # SKIP No unicode yet ok 139 # SKIP no more transcode ok 140 # SKIP no more chartype ok t/op/string_cclass.t ................... ok t/op/string_cs.t ....................... ok t/op/string_mem.t ...................... ok t/op/stringu.t ......................... ok 25 # SKIP Tests seem to fail on big endian machines with icu ok 26 # SKIP Tests seem to fail on big endian machines with icu not ok 27 - UTF-8 and Unicode literals # TODO TT #24 ok t/op/sysinfo.t ......................... not ok 11 - sysinfo OS version string # TODO Not Currently Implemented not ok 12 - sysinfo OS version number string # TODO Not Currently Implemented ok 13 # SKIP Requires a lot of work to find out the correct answer ok t/op/time.t ............................ ok t/op/trans.t ........................... ok 13 - atan2 # TODO broken under JIT TT #201 ok t/pmc/addrregistry.t ................... ok t/pmc/array.t .......................... not ok 15 - freeze/thaw # TODO freeze/thaw known to be broken ok t/pmc/bigint.t ......................... ok t/pmc/bignum.t ......................... not ok 4 - set double, get str # TODO bignum strings not ok 5 - add # TODO bignum strings not ok 6 - add_int # TODO bignum strings not ok 10 - mul # TODO bignum strings not ok 11 - mul_float # TODO bignum strings not ok 16 - bignum / by zero BigInt # TODO missing signature not ok 18 - bignum % by zero BigNum # TODO missing signature not ok 19 - bignum % by zero BigInt # TODO missing signature not ok 20 - bignum % by zero Integer # TODO missing signature not ok 23 - abs # TODO bignum strings ok t/pmc/boolean.t ........................ ok t/pmc/bound_nci.t ...................... ok t/pmc/callsignature.t .................. ok t/pmc/capture.t ........................ ok t/pmc/class.t .......................... not ok 28 # TODO add_method() invoking method added to class works ok t/pmc/codestring.t ..................... ok t/pmc/complex.t ........................ ok 58 # SKIP div by zero not caught ok 59 # SKIP div by zero not caught ok 60 # SKIP div by zero not caught ok 86 # SKIP instantiate n/y ok 87 # SKIP instantiate n/y ok 88 # SKIP instantiate n/y ok 89 # SKIP instantiate n/y ok 126 # SKIP inf is not platform-independent ok 465 # SKIP add using subclass of Complex - RT #59630 ok 466 # SKIP add using subclass of Complex - RT #59630 ok 467 # SKIP add using subclass of Complex - RT #59630 ok t/pmc/config.t ......................... ok t/pmc/continuation.t ................... ok t/pmc/coroutine.t ...................... not ok 9 - Call an exited coroutine # TODO goes one iteration too far. ok t/pmc/cpointer.t ....................... ok t/pmc/default.t ........................ not ok 1 - new # TODO not implemeted ok t/pmc/env.t ............................ ok t/pmc/eval.t ........................... ok t/pmc/eventhandler.t ................... ok t/pmc/exception.t ...................... not ok 23 - pop_eh out of context (2) # TODO runloop shenanigans not ok 25 - pushaction: error while handling error # TODO runloop shenanigans not ok 27 - invoke handler in calling sub # TODO deprecate rethrow ok 30 # SKIP intermittent segfault, RT #60556 ok t/pmc/exceptionhandler.t ............... ok t/pmc/exporter.t ....................... ok t/pmc/file.t ........................... ok t/pmc/filehandle.t ..................... ok 3 # SKIP no asynch calls yet not ok 8 - record_separator # TODO not yet implemented ok t/pmc/fixedbooleanarray.t .............. ok t/pmc/fixedfloatarray.t ................ ok t/pmc/fixedintegerarray.t .............. ok t/pmc/fixedpmcarray.t .................. ok t/pmc/fixedstringarray.t ............... ok t/pmc/float.t .......................... ok t/pmc/freeze.t ......................... ok t/pmc/globals.t ........................ ok t/pmc/hash.t ........................... ok t/pmc/integer.t ........................ ok t/pmc/io.t ............................. not ok 1 - IO on some invalid types # TODO IO on some invalid types ok 8 # SKIP clone not finished yet ok 23 # SKIP segfault, see TT #418 not ok 36 - read on null PMC throws exception # TODO not yet implemented TT #433 not ok 40 - string read/write handle # TODO no stringhandle yet ok t/pmc/io_iterator.t .................... not ok 1 - new # TODO not yet implemented not ok 2 - shift # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented ok t/pmc/io_status.t ...................... not ok 1 - new # TODO not yet implemented not ok 2 - get_integer (vtable) # TODO not yet implemented not ok 3 - get_bool (vtable) # TODO not yet implemented not ok 4 - return # TODO not yet implemented not ok 5 - error # TODO not yet implemented not ok 6 - throw # TODO not yet implemented ok t/pmc/iterator.t ....................... ok 13 # SKIP N/Y: length of rest of array not ok 16 - adding keys during iteration # TODO adding keys during iteration not ok 21 - cloned iterator doesn't copy the array to which it 'points' # TODO cloned iterator doesn't copy the array to which it 'points' ok t/pmc/key.t ............................ not ok 10 # TODO register and non-register string keys should be COW (RT #60128) ok t/pmc/lexinfo.t ........................ ok t/pmc/lexpad.t ......................... ok t/pmc/managedstruct.t .................. ok t/pmc/multidispatch.t .................. not ok 22 - MMD on PMC types - Any # TODO RT #41374 not ok 25 - add as method - inherited # TODO RT #41374 not ok 32 - use a core func for an object # TODO RT #59628 ok t/pmc/multisub.t ....................... ok t/pmc/namespace.t ...................... not ok 55 - add_sub() with error # TODO needs full implementation of PDD 17 ok t/pmc/nci.t ............................ not ok 42 - nci_cb_C1 - PASM # TODO RT #49718, add scheduler tasks to JIT not ok 43 - nci_cb_C1 - PIR # TODO RT #49718, add scheduler tasks to JIT not ok 44 - nci_cb_C2 - PASM # TODO RT #49718, add scheduler tasks to JIT not ok 45 - nci_cb_C3 - PIR # TODO RT #49718, add scheduler tasks to JIT not ok 46 - nci_cb_D1 - PASM # TODO RT #49718, add scheduler tasks to JIT not ok 47 - nci_cb_D2 - PASM # TODO RT #49718, add scheduler tasks to JIT not ok 48 - nci_cb_D2 - PIR # TODO RT #49718, add scheduler tasks to JIT not ok 49 - nci_cb_D3 - PIR # TODO RT #49718, add scheduler tasks to JIT ok t/pmc/null.t ........................... ok t/pmc/object-meths.t ................... ok 14 # SKIP currently broken ok 25 # SKIP no bound NCI method ok t/pmc/object-mro.t ..................... ok t/pmc/object.t ......................... ok t/pmc/objects.t ........................ ok t/pmc/orderedhash.t .................... ok t/pmc/os.t ............................. ok t/pmc/packfile.t ....................... ok t/pmc/packfileannotation.t ............. ok t/pmc/packfileannotationkeys.t ......... ok t/pmc/packfileannotations.t ............ ok t/pmc/packfileconstanttable.t .......... not ok 3 - get_type, get_*_keyed_int # TODO See TT #385. ok t/pmc/packfiledirectory.t .............. ok t/pmc/packfilefixupentry.t ............. ok t/pmc/packfilefixuptable.t ............. ok t/pmc/packfilerawsegment.t ............. ok t/pmc/packfilesegment.t ................ ok t/pmc/parrotclass.t .................... ok t/pmc/parrotinterpreter.t .............. ok t/pmc/parrotio.t ....................... not ok 2 - open and close - synchronous # TODO not yet implemented ok 3 # SKIP no asynch calls yet not ok 4 - print, read, and readline - synchronous # TODO not yet implemented not ok 5 - record_separator # TODO not yet implemented not ok 6 - buffer_type # TODO not yet implemented ok t/pmc/parrotlibrary.t .................. ok t/pmc/parrotobject.t ................... ok t/pmc/parrotrunningthread.t ............ ok t/pmc/parrotthread.t ................... ok t/pmc/pccmethod_test.t ................. ok t/pmc/pmc.t ............................ ok t/pmc/pmcproxy.t ....................... ok t/pmc/pointer.t ........................ ok t/pmc/prop.t ........................... ok t/pmc/random.t ......................... ok t/pmc/ref.t ............................ ok t/pmc/resizablebooleanarray.t .......... ok t/pmc/resizablefloatarray.t ............ ok t/pmc/resizableintegerarray.t .......... ok t/pmc/resizablepmcarray.t .............. ok t/pmc/resizablestringarray.t ........... ok t/pmc/retcontinuation.t ................ ok t/pmc/ro.t ............................. not ok 8 - ResizablePMCArray -- Recursive # TODO 1 ok t/pmc/role.t ........................... ok t/pmc/scalar.t ......................... ok 1 # SKIP doesn't work yet ok t/pmc/scheduler.t ...................... ok t/pmc/schedulermessage.t ............... ok t/pmc/sharedref.t ...................... ok t/pmc/signal.t ......................... skipped: Signals currently disabled t/pmc/slice.t .......................... not ok 2 - bug with slice bits # TODO parser ok t/pmc/string.t ......................... ok t/pmc/stringhandle.t ................... ok 3 # SKIP no asynch calls yet not ok 9 - record_separator # TODO not yet implemented ok t/pmc/sub.t ............................ ok t/pmc/sys.t ............................ ok t/pmc/task.t ........................... ok t/pmc/threads.t ........................ not ok 11 - CLONE_CODE | CLONE_CLASSES; superclass not built-in # TODO vtable overrides aren't properly cloned RT # 46511 not ok 14 - globals + constant table subs issue # TODO Broken with JIT not ok 15 - CLONE_CODE|CLONE_GLOBALS|CLONE_HLL|CLONE_LIBRARIES # TODO RT #41373 ok t/pmc/timer.t .......................... not ok 5 - Timer setup - initializer/start/repeat # TODO RT #49718, add scheduler features to JIT ok t/pmc/undef.t .......................... ok t/pmc/unmanagedstruct.t ................ ok t/oo/attributes.t ...................... ok t/oo/composition.t ..................... ok t/oo/inheritance.t ..................... ok t/oo/isa.t ............................. ok t/oo/metamodel.t ....................... not ok 6 # TODO tail attribute has a type not ok 12 # TODO new opcode makes working objects ok t/oo/methods.t ......................... ok t/oo/mro-c3.t .......................... ok t/oo/names.t ........................... ok t/oo/new.t ............................. ok t/oo/ops.t ............................. ok t/oo/proxy.t ........................... ok t/oo/subclass.t ........................ ok t/oo/vtableoverride.t .................. ok t/native_pbc/header.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/integer.t ................. skipped: pending robust testing strategy, TT #357 t/native_pbc/number.t .................. skipped: pending robust testing strategy, TT #357 t/native_pbc/string.t .................. skipped: pending robust testing strategy, TT #357 t/dynpmc/dynlexpad.t ................... not ok 7 - dynlexpad - iterator # TODO iterator not implemented for DynLexPads ok t/dynpmc/foo.t ......................... ok t/dynpmc/gdbmhash.t .................... ok t/dynpmc/md2.t ......................... ok t/dynpmc/md4.t ......................... ok t/dynpmc/md5.t ......................... ok t/dynpmc/pair.t ........................ ok t/dynpmc/rational.t .................... ok t/dynpmc/ripemd160.t ................... ok t/dynpmc/rotest.t ...................... ok t/dynpmc/sha.t ......................... ok t/dynpmc/sha1.t ........................ ok t/dynpmc/sha256.t ...................... ok t/dynpmc/sha512.t ...................... ok t/dynpmc/subclass_with_pir_method.t .... not ok 1 - subclass with pir method - .loadlib # TODO PMCs don't obey HLL namespaces not ok 2 - subclass with pir method - .HLL # TODO PMCs don't obey HLL namespaces ok t/dynpmc/subproxy.t .................... ok t/dynoplibs/dan.t ...................... ok t/dynoplibs/myops.t .................... not ok 4 - a short cheating quine # TODO broken with JIT not ok 5 - one alarm # TODO RT #49718, add scheduler features to JIT not ok 6 - three alarm # TODO RT #49718, add scheduler features to JIT not ok 7 - repeating alarm # TODO RT #49718, add scheduler features to JIT ok t/compilers/pct/complete_workflow.t .... ok t/compilers/pct/past.t ................. ok t/compilers/pct/pct_hllcompiler.t ...... ok t/compilers/pct/post.t ................. ok t/compilers/pge/00-basic.t ............. ok t/compilers/pge/02-match.t ............. ok # Failed test 'Simple term' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # term:a # # Failed test 'Simple infix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:+(term:a, term:b) # # Failed test 'Simple infix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:-(term:a, term:b) # # Failed test 'left associativity' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:+(infix:+(term:a, term:b), term:c) # # Failed test 'left associativity' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:-(infix:+(term:a, term:b), term:c) # # Failed test 'left associativity' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:+(infix:-(term:a, term:b), term:c) # # Failed test 'tighter precedence' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:+(term:a, infix:*(term:b, term:c)) # # Failed test 'tighter precedence' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:+(infix:*(term:a, term:b), term:c) # # Failed test 'left associativity' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:/(infix:/(term:a, term:b), term:c) # # Failed test 'left associativity' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:/(infix:*(term:a, term:b), term:c) # # Failed test 'left associativity' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:*(infix:/(term:a, term:b), term:c) # # Failed test 'looser precedence' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:=(term:a, infix:*(term:b, term:c)) # # Failed test 'right associativity' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:=(term:a, infix:=(term:b, term:c)) # # Failed test 'list associativity' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:=(term:a, infix:,(term:b, term:c, infix:+(term:d, term:e))) # # Failed test 'two terms in sequence' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # term:a (pos=1) # # Failed test 'two opers in sequence' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # term:a (pos=1) # # Failed test 'infix missing rhs' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # term:a (pos=1) # # Failed test 'postfix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # postfix:++(term:a) # # Failed test 'postfix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # postfix:--(term:a) # # Failed test 'prefix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # prefix:++(term:a) # # Failed test 'prefix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # prefix:--(term:a) # # Failed test 'prefix ltm' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # prefix:-(term:a) # # Failed test 'prefix ltm' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # term:->a # # Failed test 'circumfix parens' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:*(term:a, circumfix:( )(infix:+(term:b, term:c))) # # Failed test 'extra close paren' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:+(infix:*(term:a, term:b), term:c) (pos=5) # # Failed test 'only close paren' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # failed # # Failed test 'missing close paren' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # failed # # Failed test 'mismatch close paren' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # failed # # Failed test 'mixed tokens' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:+(postfix:++(term:a), prefix:--(term:b)) # # Failed test 'missing lhs term' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # failed # # Failed test 'postcircumfix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # postcircumfix:( )(term:a, infix:,(term:b, term:c)) # # Failed test 'nows on postcircumfix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # term:a (pos=1) # # Failed test 'nullterm in postcircumfix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # postcircumfix:( )(term:a, null) # # Failed test 'nullterm disallowed' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # term:a (pos=1) # # Failed test 'loose list associativity in circumfix' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # circumfix:( )(infix:;(infix:=(term:a, term:b), term:c, term:d)) # # Failed test 'top-level stop token' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # circumfix:( )(infix:;(term:a, term:b)) (pos=5) # # Failed test 'top-level stop token' # at t/compilers/pge/03-optable.t line 194. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # infix:,(term:a, term:b) (pos=3) # # Looks like you failed 37 tests of 37. t/compilers/pge/03-optable.t ........... Dubious, test returned 37 (wstat 9472, 0x2500) Failed 37/37 subtests t/compilers/pge/04-compile.t ........... ok t/compilers/pge/06-grammar.t ........... ok t/compilers/pge/pge-hs.t ............... ok t/compilers/pge/pge.t .................. ok # Failed test 'parse FASTA' # at t/compilers/pge/pge_examples.t line 55. # Exited with error code: [SIGNAL 11] # Received: # # Expected: # >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] # LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV # EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG # LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL # GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX # IENY # >poly_a teasing the parser with DNA # aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa # # Looks like you failed 1 test of 2. t/compilers/pge/pge_examples.t ......... Dubious, test returned 1 (wstat 256, 0x100) Failed 1/2 subtests t/compilers/pge/pge_globs.t ............ ok t/compilers/pge/pge_text.t ............. ok t/compilers/pge/pge_util.t ............. ok t/compilers/pge/p5regex/p5rx.t ......... not ok 116 # TODO [re_tests:116] character class in enumeration not ok 119 # TODO [re_tests:119] character class in enumeration not ok 120 # TODO [re_tests:120] character class in enumeration not ok 123 # TODO [re_tests:123] character class in enumeration not ok 124 # TODO [re_tests:124] character class in enumeration not ok 127 # TODO [re_tests:127] character class in enumeration ok 138 # SKIP [re_tests:138] parser bug ok 139 # SKIP [re_tests:139] broken col 4? ok 143 # SKIP [re_tests:143] bug or error ok 144 # SKIP [re_tests:144] bug or error ok 148 # SKIP [re_tests:148] bug or error ok 149 # SKIP [re_tests:149] bug or error ok 155 # SKIP [re_tests:155] bug or error ok 167 # SKIP [re_tests:167] bug or error not ok 234 # TODO [re_tests:234] unknown reason not ok 235 # TODO [re_tests:235] unknown reason not ok 236 # TODO [re_tests:236] unknown reason not ok 246 # TODO [re_tests:246] unknown reason not ok 247 # TODO [re_tests:247] unknown reason ok 248 # SKIP [re_tests:248] bug or error ok 249 # SKIP [re_tests:249] bug or error ok 252 # SKIP [re_tests:252] bug or error not ok 254 # TODO [re_tests:254] unknown reason not ok 256 # TODO [re_tests:256] unknown reason not ok 257 # TODO [re_tests:257] unknown reason ok 264 # SKIP [re_tests:264] trailing modifiers ok 265 # SKIP [re_tests:265] trailing modifiers ok 266 # SKIP [re_tests:266] trailing modifiers ok 267 # SKIP [re_tests:267] trailing modifiers ok 268 # SKIP [re_tests:268] trailing modifiers ok 269 # SKIP [re_tests:269] trailing modifiers ok 270 # SKIP [re_tests:270] trailing modifiers ok 271 # SKIP [re_tests:271] trailing modifiers ok 272 # SKIP [re_tests:272] trailing modifiers ok 273 # SKIP [re_tests:273] trailing modifiers ok 274 # SKIP [re_tests:274] trailing modifiers ok 275 # SKIP [re_tests:275] trailing modifiers ok 276 # SKIP [re_tests:276] trailing modifiers ok 277 # SKIP [re_tests:277] trailing modifiers ok 278 # SKIP [re_tests:278] trailing modifiers ok 279 # SKIP [re_tests:279] trailing modifiers ok 280 # SKIP [re_tests:280] trailing modifiers ok 281 # SKIP [re_tests:281] trailing modifiers ok 282 # SKIP [re_tests:282] trailing modifiers ok 283 # SKIP [re_tests:283] trailing modifiers ok 284 # SKIP [re_tests:284] trailing modifiers ok 285 # SKIP [re_tests:285] trailing modifiers ok 286 # SKIP [re_tests:286] trailing modifiers ok 287 # SKIP [re_tests:287] trailing modifiers ok 288 # SKIP [re_tests:288] trailing modifiers ok 289 # SKIP [re_tests:289] trailing modifiers ok 290 # SKIP [re_tests:290] trailing modifiers ok 291 # SKIP [re_tests:291] trailing modifiers ok 292 # SKIP [re_tests:292] trailing modifiers ok 293 # SKIP [re_tests:293] trailing modifiers ok 294 # SKIP [re_tests:294] trailing modifiers ok 295 # SKIP [re_tests:295] trailing modifiers ok 296 # SKIP [re_tests:296] trailing modifiers ok 297 # SKIP [re_tests:297] trailing modifiers ok 298 # SKIP [re_tests:298] trailing modifiers ok 299 # SKIP [re_tests:299] trailing modifiers ok 300 # SKIP [re_tests:300] trailing modifiers ok 301 # SKIP [re_tests:301] trailing modifiers ok 302 # SKIP [re_tests:302] trailing modifiers ok 303 # SKIP [re_tests:303] trailing modifiers ok 304 # SKIP [re_tests:304] trailing modifiers ok 305 # SKIP [re_tests:305] trailing modifiers ok 306 # SKIP [re_tests:306] trailing modifiers ok 307 # SKIP [re_tests:307] trailing modifiers ok 308 # SKIP [re_tests:308] bug or error ok 309 # SKIP [re_tests:309] bug or error ok 310 # SKIP [re_tests:310] bug or error ok 311 # SKIP [re_tests:311] trailing modifiers ok 312 # SKIP [re_tests:312] trailing modifiers ok 313 # SKIP [re_tests:313] trailing modifiers ok 314 # SKIP [re_tests:314] trailing modifiers ok 315 # SKIP [re_tests:315] trailing modifiers ok 316 # SKIP [re_tests:316] trailing modifiers ok 317 # SKIP [re_tests:317] trailing modifiers ok 318 # SKIP [re_tests:318] trailing modifiers ok 319 # SKIP [re_tests:319] trailing modifiers ok 320 # SKIP [re_tests:320] trailing modifiers ok 321 # SKIP [re_tests:321] trailing modifiers ok 322 # SKIP [re_tests:322] bug or error ok 323 # SKIP [re_tests:323] bug or error ok 324 # SKIP [re_tests:324] trailing modifiers ok 325 # SKIP [re_tests:325] bug or error ok 326 # SKIP [re_tests:326] trailing modifiers ok 327 # SKIP [re_tests:327] trailing modifiers ok 328 # SKIP [re_tests:328] trailing modifiers ok 329 # SKIP [re_tests:329] trailing modifiers ok 330 # SKIP [re_tests:330] bug or error ok 331 # SKIP [re_tests:331] bug or error ok 332 # SKIP [re_tests:332] trailing modifiers ok 333 # SKIP [re_tests:333] trailing modifiers ok 334 # SKIP [re_tests:334] trailing modifiers ok 335 # SKIP [re_tests:335] trailing modifiers ok 336 # SKIP [re_tests:336] bug or error ok 337 # SKIP [re_tests:337] trailing modifiers ok 338 # SKIP [re_tests:338] trailing modifiers ok 339 # SKIP [re_tests:339] trailing modifiers ok 340 # SKIP [re_tests:340] trailing modifiers ok 341 # SKIP [re_tests:341] trailing modifiers ok 342 # SKIP [re_tests:342] trailing modifiers ok 343 # SKIP [re_tests:343] trailing modifiers ok 344 # SKIP [re_tests:344] trailing modifiers ok 345 # SKIP [re_tests:345] trailing modifiers ok 346 # SKIP [re_tests:346] trailing modifiers ok 347 # SKIP [re_tests:347] bug or error ok 348 # SKIP [re_tests:348] trailing modifiers ok 349 # SKIP [re_tests:349] trailing modifiers ok 350 # SKIP [re_tests:350] trailing modifiers ok 351 # SKIP [re_tests:351] trailing modifiers ok 352 # SKIP [re_tests:352] trailing modifiers ok 353 # SKIP [re_tests:353] trailing modifiers ok 354 # SKIP [re_tests:354] trailing modifiers ok 355 # SKIP [re_tests:355] trailing modifiers ok 356 # SKIP [re_tests:356] trailing modifiers ok 357 # SKIP [re_tests:357] trailing modifiers ok 358 # SKIP [re_tests:358] trailing modifiers ok 359 # SKIP [re_tests:359] trailing modifiers ok 360 # SKIP [re_tests:360] trailing modifiers ok 361 # SKIP [re_tests:361] trailing modifiers ok 362 # SKIP [re_tests:362] trailing modifiers ok 363 # SKIP [re_tests:363] trailing modifiers ok 364 # SKIP [re_tests:364] trailing modifiers ok 365 # SKIP [re_tests:365] trailing modifiers ok 366 # SKIP [re_tests:366] trailing modifiers ok 367 # SKIP [re_tests:367] trailing modifiers ok 368 # SKIP [re_tests:368] trailing modifiers ok 369 # SKIP [re_tests:369] trailing modifiers ok 370 # SKIP [re_tests:370] trailing modifiers ok 371 # SKIP [re_tests:371] trailing modifiers ok 372 # SKIP [re_tests:372] trailing modifiers ok 373 # SKIP [re_tests:373] trailing modifiers ok 374 # SKIP [re_tests:374] trailing modifiers ok 375 # SKIP [re_tests:375] trailing modifiers ok 376 # SKIP [re_tests:376] trailing modifiers ok 377 # SKIP [re_tests:377] trailing modifiers ok 378 # SKIP [re_tests:378] trailing modifiers ok 379 # SKIP [re_tests:379] trailing modifiers ok 380 # SKIP [re_tests:380] trailing modifiers ok 381 # SKIP [re_tests:381] trailing modifiers ok 382 # SKIP [re_tests:382] trailing modifiers ok 383 # SKIP [re_tests:383] trailing modifiers ok 384 # SKIP [re_tests:384] trailing modifiers ok 385 # SKIP [re_tests:385] trailing modifiers ok 386 # SKIP [re_tests:386] trailing modifiers ok 387 # SKIP [re_tests:387] trailing modifiers ok 388 # SKIP [re_tests:388] trailing modifiers ok 389 # SKIP [re_tests:389] trailing modifiers ok 390 # SKIP [re_tests:390] trailing modifiers ok 391 # SKIP [re_tests:391] trailing modifiers ok 392 # SKIP [re_tests:392] trailing modifiers ok 393 # SKIP [re_tests:393] trailing modifiers ok 394 # SKIP [re_tests:394] trailing modifiers ok 395 # SKIP [re_tests:395] trailing modifiers not ok 396 # TODO [re_tests:396] unknown reason not ok 397 # TODO [re_tests:397] unknown reason not ok 398 # TODO [re_tests:398] unknown reason ok 408 # SKIP [re_tests:408] bug or error not ok 419 # TODO [re_tests:419] unknown reason not ok 422 # TODO [re_tests:422] unknown reason not ok 429 # TODO [re_tests:429] unknown reason not ok 432 # TODO [re_tests:432] unknown reason not ok 434 # TODO [re_tests:434] unknown reason not ok 435 # TODO [re_tests:435] unknown reason ok 436 # SKIP [re_tests:436] bug or error not ok 439 # TODO [re_tests:439] unknown reason not ok 446 # TODO [re_tests:446] unknown reason not ok 447 # TODO [re_tests:447] unknown reason not ok 448 # TODO [re_tests:448] unknown reason not ok 449 # TODO [re_tests:449] unknown reason not ok 452 # TODO [re_tests:452] unknown reason not ok 453 # TODO [re_tests:453] unknown reason not ok 454 # TODO [re_tests:454] unknown reason not ok 455 # TODO [re_tests:455] unknown reason ok 458 # SKIP [re_tests:458] unknown reason ok 459 # SKIP [re_tests:459] unknown reason ok 460 # SKIP [re_tests:460] unknown reason ok 461 # SKIP [re_tests:461] unknown reason ok 462 # SKIP [re_tests:462] unknown reason ok 463 # SKIP [re_tests:463] unknown reason ok 464 # SKIP [re_tests:464] unknown reason ok 465 # SKIP [re_tests:465] unknown reason ok 466 # SKIP [re_tests:466] unknown reason ok 467 # SKIP [re_tests:467] unknown reason ok 468 # SKIP [re_tests:468] unknown reason ok 469 # SKIP [re_tests:469] unknown reason ok 470 # SKIP [re_tests:470] unknown reason ok 471 # SKIP [re_tests:471] unknown reason ok 472 # SKIP [re_tests:472] unknown reason ok 473 # SKIP [re_tests:473] unknown reason ok 474 # SKIP [re_tests:474] unknown reason ok 475 # SKIP [re_tests:475] unknown reason ok 476 # SKIP [re_tests:476] unknown reason ok 477 # SKIP [re_tests:477] unknown reason ok 478 # SKIP [re_tests:478] unknown reason ok 479 # SKIP [re_tests:479] unknown reason ok 480 # SKIP [re_tests:480] unknown reason ok 483 # SKIP [re_tests:483] ok 484 # SKIP [re_tests:484] ok 487 # SKIP [re_tests:487] bug or error ok 488 # SKIP [re_tests:488] bug or error ok 489 # SKIP [re_tests:489] bug or error ok 490 # SKIP [re_tests:490] bug or error ok 491 # SKIP [re_tests:491] kills a parrot ok 492 # SKIP [re_tests:492] bug or error ok 493 # SKIP [re_tests:493] kills a parrot not ok 495 # TODO [re_tests:495] unknown reason ok 496 # SKIP [re_tests:496] not ok 498 # TODO [re_tests:498] unknown reason not ok 500 # TODO [re_tests:500] unknown reason not ok 501 # TODO [re_tests:501] unknown reason ok 502 # SKIP [re_tests:502] unknown reason not ok 503 # TODO [re_tests:503] unknown reason not ok 504 # TODO [re_tests:504] unknown reason not ok 505 # TODO [re_tests:505] unknown reason not ok 506 # TODO [re_tests:506] unknown reason not ok 507 # TODO [re_tests:507] unknown reason not ok 508 # TODO [re_tests:508] unknown reason not ok 509 # TODO [re_tests:509] unknown reason not ok 510 # TODO [re_tests:510] unknown reason not ok 511 # TODO [re_tests:511] unknown reason not ok 512 # TODO [re_tests:512] unknown reason not ok 515 # TODO [re_tests:515] unknown reason not ok 521 # TODO [re_tests:521] unknown reason not ok 522 # TODO [re_tests:522] unknown reason not ok 523 # TODO [re_tests:523] unknown reason not ok 524 # TODO [re_tests:524] unknown reason not ok 527 # TODO [re_tests:527] unknown reason not ok 528 # TODO [re_tests:528] unknown reason ok 531 # SKIP [re_tests:531] bug or error ok 532 # SKIP [re_tests:532] bug or error not ok 535 # TODO [re_tests:535] unknown reason not ok 536 # TODO [re_tests:536] unknown reason not ok 539 # TODO [re_tests:539] unknown reason not ok 540 # TODO [re_tests:540] unknown reason not ok 541 # TODO [re_tests:541] unknown reason not ok 544 # TODO [re_tests:544] unknown reason not ok 545 # TODO [re_tests:545] unknown reason ok 556 # SKIP [re_tests:556] kills a parrot ok 557 # SKIP [re_tests:557] kills a parrot not ok 559 # TODO [re_tests:559] unknown reason ok 563 # SKIP [re_tests:563] bug or error ok 564 # SKIP [re_tests:564] bug or error ok 566 # SKIP [re_tests:566] bug or error ok 568 # SKIP [re_tests:568] kills a parrot ok 569 # SKIP [re_tests:569] kills a parrot ok 570 # SKIP [re_tests:570] kills a parrot ok 571 # SKIP [re_tests:571] kills a parrot ok 572 # SKIP [re_tests:572] kills a parrot ok 573 # SKIP [re_tests:573] kills a parrot ok 574 # SKIP [re_tests:574] kills a parrot ok 575 # SKIP [re_tests:575] kills a parrot ok 576 # SKIP [re_tests:576] kills a parrot ok 577 # SKIP [re_tests:577] kills a parrot ok 578 # SKIP [re_tests:578] kills a parrot ok 579 # SKIP [re_tests:579] kills a parrot ok 580 # SKIP [re_tests:580] kills a parrot ok 581 # SKIP [re_tests:581] kills a parrot ok 582 # SKIP [re_tests:582] kills a parrot ok 583 # SKIP [re_tests:583] kills a parrot ok 584 # SKIP [re_tests:584] kills a parrot ok 585 # SKIP [re_tests:585] kills a parrot ok 586 # SKIP [re_tests:586] kills a parrot ok 587 # SKIP [re_tests:587] kills a parrot ok 588 # SKIP [re_tests:588] kills a parrot ok 589 # SKIP [re_tests:589] kills a parrot ok 590 # SKIP [re_tests:590] kills a parrot ok 591 # SKIP [re_tests:591] kills a parrot ok 592 # SKIP [re_tests:592] kills a parrot ok 593 # SKIP [re_tests:593] bug or error ok 594 # SKIP [re_tests:594] bug or error not ok 595 # TODO [re_tests:595] unknown reason not ok 596 # TODO [re_tests:596] unknown reason ok 597 # SKIP [re_tests:597] unknown reason ok 598 # SKIP [re_tests:598] bug or error ok 599 # SKIP [re_tests:599] bug or error not ok 600 # TODO [re_tests:600] unknown reason not ok 601 # TODO [re_tests:601] unknown reason not ok 603 # TODO [re_tests:603] unknown reason not ok 604 # TODO [re_tests:604] unknown reason not ok 606 # TODO [re_tests:606] unknown reason not ok 607 # TODO [re_tests:607] unknown reason ok 609 # SKIP [re_tests:609] unknown reason ok 610 # SKIP [re_tests:610] unknown reason ok 611 # SKIP [re_tests:611] unknown reason ok 612 # SKIP [re_tests:612] unknown reason ok 613 # SKIP [re_tests:613] unknown reason ok 614 # SKIP [re_tests:614] unknown reason ok 615 # SKIP [re_tests:615] unknown reason ok 616 # SKIP [re_tests:616] unknown reason ok 617 # SKIP [re_tests:617] unknown reason not ok 621 # TODO [re_tests:621] unknown reason not ok 623 # TODO [re_tests:623] unknown reason not ok 624 # TODO [re_tests:624] unknown reason not ok 625 # TODO [re_tests:625] unknown reason ok 627 # SKIP [re_tests:627] unknown reason ok 628 # SKIP [re_tests:628] unknown reason ok 629 # SKIP [re_tests:629] unknown reason ok 630 # SKIP [re_tests:630] unknown reason ok 631 # SKIP [re_tests:631] unknown reason ok 632 # SKIP [re_tests:632] unknown reason ok 633 # SKIP [re_tests:633] unknown reason ok 634 # SKIP [re_tests:634] unknown reason ok 635 # SKIP [re_tests:635] unknown reason not ok 639 # TODO [re_tests:639] unknown reason not ok 641 # TODO [re_tests:641] unknown reason not ok 642 # TODO [re_tests:642] unknown reason not ok 643 # TODO [re_tests:643] unknown reason ok 645 # SKIP [re_tests:645] unknown reason ok 646 # SKIP [re_tests:646] unknown reason ok 647 # SKIP [re_tests:647] unknown reason ok 648 # SKIP [re_tests:648] unknown reason ok 649 # SKIP [re_tests:649] unknown reason ok 650 # SKIP [re_tests:650] unknown reason ok 651 # SKIP [re_tests:651] unknown reason ok 652 # SKIP [re_tests:652] unknown reason ok 653 # SKIP [re_tests:653] unknown reason ok 663 # SKIP [re_tests:663] unknown reason ok 664 # SKIP [re_tests:664] unknown reason ok 665 # SKIP [re_tests:665] unknown reason ok 666 # SKIP [re_tests:666] unknown reason ok 667 # SKIP [re_tests:667] unknown reason ok 668 # SKIP [re_tests:668] unknown reason ok 669 # SKIP [re_tests:669] unknown reason ok 670 # SKIP [re_tests:670] unknown reason ok 671 # SKIP [re_tests:671] unknown reason ok 681 # SKIP [re_tests:681] unknown reason ok 682 # SKIP [re_tests:682] unknown reason ok 683 # SKIP [re_tests:683] unknown reason ok 684 # SKIP [re_tests:684] unknown reason ok 685 # SKIP [re_tests:685] unknown reason ok 686 # SKIP [re_tests:686] unknown reason ok 687 # SKIP [re_tests:687] unknown reason ok 688 # SKIP [re_tests:688] unknown reason ok 689 # SKIP [re_tests:689] unknown reason not ok 693 # TODO [re_tests:693] unknown reason not ok 695 # TODO [re_tests:695] unknown reason not ok 696 # TODO [re_tests:696] unknown reason not ok 697 # TODO [re_tests:697] unknown reason ok 699 # SKIP [re_tests:699] unknown reason ok 700 # SKIP [re_tests:700] unknown reason ok 701 # SKIP [re_tests:701] unknown reason ok 702 # SKIP [re_tests:702] unknown reason ok 703 # SKIP [re_tests:703] unknown reason ok 704 # SKIP [re_tests:704] unknown reason ok 705 # SKIP [re_tests:705] unknown reason ok 706 # SKIP [re_tests:706] unknown reason ok 707 # SKIP [re_tests:707] unknown reason ok 717 # SKIP [re_tests:717] unknown reason ok 718 # SKIP [re_tests:718] unknown reason ok 719 # SKIP [re_tests:719] unknown reason ok 720 # SKIP [re_tests:720] unknown reason ok 721 # SKIP [re_tests:721] unknown reason ok 722 # SKIP [re_tests:722] unknown reason ok 723 # SKIP [re_tests:723] unknown reason ok 724 # SKIP [re_tests:724] unknown reason ok 725 # SKIP [re_tests:725] unknown reason ok 735 # SKIP [re_tests:735] unknown reason ok 736 # SKIP [re_tests:736] unknown reason ok 737 # SKIP [re_tests:737] unknown reason ok 738 # SKIP [re_tests:738] unknown reason ok 739 # SKIP [re_tests:739] unknown reason ok 740 # SKIP [re_tests:740] unknown reason ok 741 # SKIP [re_tests:741] unknown reason ok 742 # SKIP [re_tests:742] unknown reason ok 743 # SKIP [re_tests:743] unknown reason not ok 747 # TODO [re_tests:747] unknown reason not ok 749 # TODO [re_tests:749] unknown reason not ok 750 # TODO [re_tests:750] unknown reason not ok 751 # TODO [re_tests:751] unknown reason ok 753 # SKIP [re_tests:753] unknown reason ok 754 # SKIP [re_tests:754] unknown reason ok 755 # SKIP [re_tests:755] unknown reason ok 756 # SKIP [re_tests:756] unknown reason ok 757 # SKIP [re_tests:757] unknown reason ok 758 # SKIP [re_tests:758] unknown reason ok 759 # SKIP [re_tests:759] unknown reason ok 760 # SKIP [re_tests:760] unknown reason ok 761 # SKIP [re_tests:761] unknown reason ok 771 # SKIP [re_tests:771] unknown reason ok 772 # SKIP [re_tests:772] unknown reason ok 773 # SKIP [re_tests:773] unknown reason ok 774 # SKIP [re_tests:774] unknown reason ok 775 # SKIP [re_tests:775] unknown reason ok 776 # SKIP [re_tests:776] unknown reason ok 777 # SKIP [re_tests:777] unknown reason ok 778 # SKIP [re_tests:778] unknown reason ok 779 # SKIP [re_tests:779] unknown reason ok 789 # SKIP [re_tests:789] unknown reason ok 790 # SKIP [re_tests:790] unknown reason ok 791 # SKIP [re_tests:791] unknown reason ok 792 # SKIP [re_tests:792] unknown reason ok 793 # SKIP [re_tests:793] unknown reason ok 794 # SKIP [re_tests:794] unknown reason ok 795 # SKIP [re_tests:795] unknown reason ok 796 # SKIP [re_tests:796] unknown reason ok 797 # SKIP [re_tests:797] unknown reason ok 800 # SKIP [re_tests:800] not ok 801 # TODO [re_tests:801] unknown reason ok 802 # SKIP [re_tests:802] ok 803 # SKIP [re_tests:803] ok 805 # SKIP [re_tests:805] ok 806 # SKIP [re_tests:806] hangs a parrot ok 807 # SKIP [re_tests:807] hangs a parrot ok 808 # SKIP [re_tests:808] hangs a parrot ok 809 # SKIP [re_tests:809] hangs a parrot ok 810 # SKIP [re_tests:810] hangs a parrot ok 811 # SKIP [re_tests:811] hangs a parrot ok 812 # SKIP [re_tests:812] hangs a parrot ok 813 # SKIP [re_tests:813] hangs a parrot ok 814 # SKIP [re_tests:814] hangs a parrot ok 815 # SKIP [re_tests:815] hangs a parrot ok 816 # SKIP [re_tests:816] hangs a parrot ok 817 # SKIP [re_tests:817] hangs a parrot ok 818 # SKIP [re_tests:818] hangs a parrot ok 819 # SKIP [re_tests:819] hangs a parrot ok 820 # SKIP [re_tests:820] hangs a parrot ok 821 # SKIP [re_tests:821] hangs a parrot ok 822 # SKIP [re_tests:822] hangs a parrot ok 823 # SKIP [re_tests:823] hangs a parrot not ok 827 # TODO [re_tests:827] \d in character class ok 828 # SKIP [re_tests:828] ok 829 # SKIP [re_tests:829] ok 830 # SKIP [re_tests:830] ok 834 # SKIP [re_tests:834] ok 835 # SKIP [re_tests:835] ok 836 # SKIP [re_tests:836] ok 838 # SKIP [re_tests:838] not ok 858 # TODO [re_tests:858] unknown reason ok 859 # SKIP [re_tests:859] ok 862 # SKIP [re_tests:862] not ok 865 # TODO [re_tests:865] unknown reason not ok 866 # TODO [re_tests:866] unknown reason ok 877 # SKIP [re_tests:877] ok 879 # SKIP [re_tests:879] [ID 20010811.006] not ok 881 # TODO [re_tests:881] unknown reason ok 886 # SKIP [re_tests:886] not ok 887 # TODO [re_tests:887] unknown reason not ok 888 # TODO [re_tests:888] unknown reason not ok 890 # TODO [re_tests:890] unknown reason not ok 891 # TODO [re_tests:891] unknown reason not ok 893 # TODO [re_tests:893] unknown reason not ok 896 # TODO [re_tests:896] unknown reason not ok 897 # TODO [re_tests:897] unknown reason not ok 898 # TODO [re_tests:898] unknown reason not ok 899 # TODO [re_tests:899] unknown reason not ok 901 # TODO [re_tests:901] greediness/lookbehind not ok 904 # TODO [re_tests:904] greediness/lookbehind not ok 905 # TODO [re_tests:905] greediness/lookbehind not ok 907 # TODO [re_tests:907] non-greedy/zero-width assertion not ok 908 # TODO [re_tests:908] non-greedy/zero-width assertion not ok 910 # TODO [re_tests:910] non-greedy/zero-width assertion not ok 913 # TODO [re_tests:913] non-greedy/zero-width assertion not ok 914 # TODO [re_tests:914] non-greedy/zero-width assertion not ok 915 # TODO [re_tests:915] non-greedy/lookbehind not ok 916 # TODO [re_tests:916] non-greedy/lookbehind not ok 918 # TODO [re_tests:918] non-greedy/lookbehind not ok 921 # TODO [re_tests:921] non-greedy/lookbehind not ok 922 # TODO [re_tests:922] non-greedy/lookbehind not ok 923 # TODO [re_tests:923] unmatched bracket ok 924 # SKIP [re_tests:924] ok 926 # SKIP [re_tests:926] [perl #18019] not ok 927 # TODO [re_tests:927] 16 tests for [perl #23171] not ok 928 # TODO [re_tests:928] reuse captured group not ok 929 # TODO [re_tests:929] reuse captured group not ok 930 # TODO [re_tests:930] reuse captured group not ok 931 # TODO [re_tests:931] reuse captured group not ok 932 # TODO [re_tests:932] reuse captured group not ok 933 # TODO [re_tests:933] reuse captured group not ok 934 # TODO [re_tests:934] reuse captured group not ok 935 # TODO [re_tests:935] reuse captured group not ok 936 # TODO [re_tests:936] reuse captured group not ok 937 # TODO [re_tests:937] reuse captured group not ok 938 # TODO [re_tests:938] reuse captured group not ok 939 # TODO [re_tests:939] reuse captured group not ok 940 # TODO [re_tests:940] reuse captured group not ok 941 # TODO [re_tests:941] reuse captured group not ok 942 # TODO [re_tests:942] reuse captured group ok 944 # SKIP [re_tests:944] unknown reason ok 945 # SKIP [re_tests:945] unknown reason ok 957 # SKIP [re_tests:957] ok 958 # SKIP [re_tests:958] not ok 959 # TODO [re_tests:959] [perl #34195] not ok 960 # TODO [re_tests:960] non-greedy/zero-width assertion ok t/compilers/pge/perl6regex/01-regex.t .. not ok 93 # TODO [rx_metachars:107] alternation and conjunction (&|) - parse error not ok 99 # TODO [rx_metachars:114] null pattern invalid not ok 386 # TODO [rx_backtrack:4] basic not ok 427 # TODO [rx_charclass:26] illegal character range not ok 458 # TODO [rx_charclass:62] literal match (\") not ok 459 # TODO [rx_charclass:64] literal match (\") not ok 460 # TODO [rx_charclass:66] literal match with quote not ok 461 # TODO [rx_charclass:68] literal match with quote not ok 462 # TODO [rx_charclass:70] literal match with backslash not ok 463 # TODO [rx_charclass:72] literal match with interpolation not ok 464 # TODO [rx_charclass:74] literal match with interpolation not ok 653 # TODO [rx_modifiers:46] ignorecase, lexical repetition (:i) not ok 687 # TODO [rx_modifiers:99] sigspace, lexical repetition (:s) not ok 689 # TODO [rx_modifiers:102] sigspace, lexical repetition (:s) not ok 691 # TODO [rx_modifiers:105] sigspace, lexical repetition (:s) not ok 709 # TODO [rx_modifiers:131] basic ws match not ok 714 # TODO [rx_modifiers:139] perl5 syntax (:perl5) not ok 719 # TODO [rx_modifiers:149] nth occurance (:nth) not ok 720 # TODO [rx_modifiers:151] nth occurance (:nth) ok t/compilers/pge/perl6regex/context.t ... not ok 16 - numbered as named ($2 => $/[1]) # TODO not yet implemented ok t/compilers/tge/basic.t ................ ok t/compilers/tge/grammar.t .............. not ok 3 - two rules of the same name can apply to the same node, when called with a different dummy type # TODO unresolved bug ok t/compilers/tge/parser.t ............... ok t/library/cgi_query_hash.t ............. ok t/library/coroutine.t .................. ok t/library/dumper.t ..................... ok t/library/getopt_obj.t ................. ok t/library/hllmacros.t .................. ok t/library/iter.t ....................... ok t/library/md5.t ........................ ok t/library/mime_base64.t ................ ok t/library/mt19937ar.t .................. ok t/library/p6object.t ................... not ok 149 # TODO < ResizablePMCArray_obj.^isa(List) > ok t/library/parrotlib.t .................. ok t/library/pcre.t ....................... ok 1 # SKIP no pcre-config ok t/library/pg.t ......................... ok 1 # SKIP skipped ok 2 # SKIP skipped ok 3 # SKIP skipped ok 4 # SKIP skipped ok 5 # SKIP skipped ok 6 # SKIP skipped ok 7 # SKIP skipped ok 8 # SKIP skipped ok 9 # SKIP skipped ok 10 # SKIP skipped ok 11 # SKIP skipped ok 12 # SKIP skipped ok 13 # SKIP skipped ok 14 # SKIP skipped ok 15 # SKIP skipped ok 16 # SKIP skipped ok 17 # SKIP skipped ok 18 # SKIP skipped ok 19 # SKIP skipped ok 20 # SKIP skipped ok 21 # SKIP skipped ok 22 # SKIP skipped ok 23 # SKIP skipped ok 24 # SKIP skipped ok 25 # SKIP skipped ok 26 # SKIP skipped ok 27 # SKIP skipped ok 28 # SKIP skipped ok 29 # SKIP skipped ok 30 # SKIP skipped ok 31 # SKIP skipped ok 32 # SKIP skipped ok 33 # SKIP skipped ok 34 # SKIP skipped ok 35 # SKIP skipped ok 36 # SKIP skipped ok 37 # SKIP skipped ok 38 # SKIP skipped ok 39 # SKIP skipped ok 40 # SKIP skipped ok 41 # SKIP skipped ok 42 # SKIP skipped ok 43 # SKIP skipped ok t/library/protoobject.t ................ ok t/library/rand.t ....................... ok t/library/range.t ...................... ok t/library/streams.t .................... ok 18 # SKIP broken method invocation ok 20 # SKIP broken method invocation ok t/library/string_utils.t ............... ok t/library/tcl_glob.t ................... ok t/library/tcl_lib.t .................... ok t/library/test_builder_tester.t ........ ok t/library/test_class.t ................. ok t/library/test_more.t .................. ok t/library/uuid.t ....................... ok t/library/yaml_dumper.t ................ not ok 7 - properties # TODO not yet implemented not ok 8 - indent string # TODO not supported not ok 9 - back-referencing properties # TODO not yet implemented not ok 10 - self-referential properties (1) # TODO not yet implemented not ok 11 - self-referential properties (2) # TODO not yet implemented not ok 26 - custom dumper # TODO not yet implemented ok t/library/yaml_parser_syck.t ........... not ok 1 - basic parsing # TODO Not properly implemented yet ok Test Summary Report ------------------- t/op/bitwise.t (Wstat: 0 Tests: 27 Failed: 0) TODO passed: 27 t/op/trans.t (Wstat: 0 Tests: 22 Failed: 0) TODO passed: 13 t/compilers/pge/03-optable.t (Wstat: 9472 Tests: 37 Failed: 37) Failed tests: 1-37 Non-zero exit status: 37 t/compilers/pge/pge_examples.t (Wstat: 256 Tests: 2 Failed: 1) Failed test: 2 Non-zero exit status: 1 Files=255, Tests=8157, 380 wallclock secs ( 3.15 usr 0.64 sys + 142.71 cusr 35.06 csys = 181.56 CPU) Result: FAIL gmake[1]: *** [testj] Error 1 gmake[1]: Leaving directory `/builddir/build/BUILD/parrot-1.0.0' make: [fulltest] Error 2 (ignored) + exit 0 Processing files: parrot-1.0.0-6.fc9 Executing(%doc): /bin/sh -e /var/tmp/rpm-tmp.43326 + umask 022 + cd /builddir/build/BUILD + cd parrot-1.0.0 + DOCDIR=/var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-1.0.0 + export DOCDIR + rm -rf /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-1.0.0 + /bin/mkdir -p /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-1.0.0 + cp -pr ChangeLog CREDITS NEWS PBC_COMPAT PLATFORMS README /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-1.0.0 + cp -pr RESPONSIBLE_PARTIES TODO LICENSE /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-1.0.0 + exit 0 Provides: digest_group.so dynlexpad.so gdbmhash.so libnci_test.so libparrot.so.1.0.0 rational.so subproxy.so Requires(interp): /sbin/ldconfig /sbin/ldconfig Requires(rpmlib): rpmlib(CompressedFileNames) <= 3.0.4-1 rpmlib(PayloadFilesHavePrefix) <= 4.0-1 Requires(post): /sbin/ldconfig Requires(postun): /sbin/ldconfig Requires: libc.so.6 libc.so.6(GLIBC_2.0) libc.so.6(GLIBC_2.1) libc.so.6(GLIBC_2.1.3) libc.so.6(GLIBC_2.2) libc.so.6(GLIBC_2.3) libc.so.6(GLIBC_2.3.4) libc.so.6(GLIBC_2.4) libcrypto.so.7 libgcc_s.so.1 libgcc_s.so.1(GCC_3.0) libgcc_s.so.1(GCC_3.3.1) libgdbm.so.2 libgmp.so.3 libicudata.so.38 libicuuc.so.38 libm.so.6 libm.so.6(GLIBC_2.0) libncurses.so.5 libparrot.so.1.0.0 libpthread.so.0 libpthread.so.0(GLIBC_2.0) libpthread.so.0(GLIBC_2.1) libpthread.so.0(GLIBC_2.2) libpthread.so.0(GLIBC_2.3.2) libpthread.so.0(GLIBC_2.3.3) libpthread.so.0(GLIBC_2.3.4) libreadline.so.5 rtld(GNU_HASH) Processing files: parrot-docs-1.0.0-6.fc9 Executing(%doc): /bin/sh -e /var/tmp/rpm-tmp.65719 + umask 022 + cd /builddir/build/BUILD + cd parrot-1.0.0 + DOCDIR=/var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-docs-1.0.0 + export DOCDIR + rm -rf /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-docs-1.0.0 + /bin/mkdir -p /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-docs-1.0.0 + cp -pr docs examples /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild/usr/share/doc/parrot-docs-1.0.0 + exit 0 /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found /usr/lib/rpm/pythondeps.sh: line 8: python: command not found Requires(rpmlib): rpmlib(CompressedFileNames) <= 3.0.4-1 rpmlib(PayloadFilesHavePrefix) <= 4.0-1 Requires: perl(strict) perl(warnings) Processing files: parrot-devel-1.0.0-6.fc9 Requires(rpmlib): rpmlib(CompressedFileNames) <= 3.0.4-1 rpmlib(PayloadFilesHavePrefix) <= 4.0-1 Requires: libc.so.6 libc.so.6(GLIBC_2.0) libc.so.6(GLIBC_2.1) libc.so.6(GLIBC_2.3.4) libc.so.6(GLIBC_2.4) libgmp.so.3 libicudata.so.38 libicuuc.so.38 libm.so.6 libncurses.so.5 libparrot.so.1.0.0 libpthread.so.0 libpthread.so.0(GLIBC_2.0) libreadline.so.5 parrot = 1.0.0-6.fc9 pkgconfig rtld(GNU_HASH) Processing files: parrot-tools-1.0.0-6.fc9 Provides: perl(Parrot::BuildUtil) perl(Parrot::Config) perl(Parrot::Config::Generated) perl(Parrot::Configure) perl(Parrot::Configure::Compiler) perl(Parrot::Configure::Data) perl(Parrot::Configure::Messages) perl(Parrot::Configure::Options) perl(Parrot::Configure::Options::Conf) perl(Parrot::Configure::Options::Conf::CLI) perl(Parrot::Configure::Options::Conf::File) perl(Parrot::Configure::Options::Conf::Shared) perl(Parrot::Configure::Options::Reconf) perl(Parrot::Configure::Options::Test) perl(Parrot::Configure::Options::Test::Prepare) perl(Parrot::Configure::Step) perl(Parrot::Configure::Step::List) perl(Parrot::Configure::Step::Methods) perl(Parrot::Configure::Test) perl(Parrot::Configure::Trace) perl(Parrot::Configure::Utils) perl(Parrot::Distribution) perl(Parrot::Docs::Directory) perl(Parrot::Docs::File) perl(Parrot::Docs::Group) perl(Parrot::Docs::HTMLPage) perl(Parrot::Docs::Item) perl(Parrot::Docs::POD2HTML) = 1.0 perl(Parrot::Docs::Section) perl(Parrot::Docs::Section::C) perl(Parrot::Docs::Section::Compilers) perl(Parrot::Docs::Section::Config) perl(Parrot::Docs::Section::Developer) perl(Parrot::Docs::Section::Examples) perl(Parrot::Docs::Section::IMCC) perl(Parrot::Docs::Section::Info) perl(Parrot::Docs::Section::Libs) perl(Parrot::Docs::Section::Ops) perl(Parrot::Docs::Section::PDDs) perl(Parrot::Docs::Section::PMCs) perl(Parrot::Docs::Section::Parrot) perl(Parrot::Docs::Section::Perl) perl(Parrot::Docs::Section::Tests) perl(Parrot::Docs::Section::Tools) perl(Parrot::Docs::Text2HTML) perl(Parrot::Harness::DefaultTests) perl(Parrot::Harness::Options) perl(Parrot::Harness::Smoke) perl(Parrot::Headerizer) perl(Parrot::IO::Directory) perl(Parrot::IO::File) perl(Parrot::IO::Path) perl(Parrot::Manifest) perl(Parrot::Op) perl(Parrot::OpLib::core) perl(Parrot::OpTrans) perl(Parrot::OpTrans::C) perl(Parrot::OpTrans::CGP) perl(Parrot::OpTrans::CGoto) perl(Parrot::OpTrans::CPrederef) perl(Parrot::OpTrans::CSwitch) perl(Parrot::OpTrans::Compiled) perl(Parrot::Ops2c::Auxiliary) perl(Parrot::Ops2c::Utils) perl(Parrot::Ops2pm) perl(Parrot::Ops2pm::Auxiliary) perl(Parrot::Ops2pm::Base) perl(Parrot::OpsFile) perl(Parrot::OpsRenumber) perl(Parrot::PMC) perl(Parrot::Pmc2c::Attribute) perl(Parrot::Pmc2c::ComposedMethod) perl(Parrot::Pmc2c::Dumper) perl(Parrot::Pmc2c::Emitter) perl(Parrot::Pmc2c::Library) perl(Parrot::Pmc2c::MULTI) perl(Parrot::Pmc2c::Method) perl(Parrot::Pmc2c::MethodEmitter) = 1.0.0 perl(Parrot::Pmc2c::Object) perl(Parrot::Pmc2c::PCCMETHOD) perl(Parrot::Pmc2c::PCCMETHOD_BITS) = 1.0.0 perl(Parrot::Pmc2c::PMC) perl(Parrot::Pmc2c::PMC::Null) perl(Parrot::Pmc2c::PMC::Object) perl(Parrot::Pmc2c::PMC::ParrotClass) perl(Parrot::Pmc2c::PMC::PrintTree) perl(Parrot::Pmc2c::PMC::RO) perl(Parrot::Pmc2c::PMC::Ref) perl(Parrot::Pmc2c::PMC::SharedRef) perl(Parrot::Pmc2c::PMC::default) perl(Parrot::Pmc2c::PMCEmitter) = 1.0.0 perl(Parrot::Pmc2c::Parser) perl(Parrot::Pmc2c::Pmc2cMain) perl(Parrot::Pmc2c::UtilFunctions) perl(Parrot::Pmc2c::VTable) perl(Parrot::Revision) perl(Parrot::SearchOps) perl(Parrot::Test) perl(Parrot::Test::Cardinal) perl(Parrot::Test::Harness) perl(Parrot::Test::PGE) perl(Parrot::Test::PIR_PGE) perl(Parrot::Test::Perl6) perl(Parrot::Test::Pod) perl(Parrot::Test::Pod::Utils) perl(Parrot::Test::Util) perl(Parrot::Test::Util::Runloop) perl(Parrot::Vtable) Requires(rpmlib): rpmlib(CompressedFileNames) <= 3.0.4-1 rpmlib(PayloadFilesHavePrefix) <= 4.0-1 rpmlib(VersionedDependencies) <= 3.0.3-1 Requires: /usr/bin/parrot /usr/bin/perl parrot = 1.0.0-6.fc9 perl >= 0:5.008 perl(Carp) perl(Class::Struct) perl(Cwd) perl(Data::Dumper) perl(DirHandle) perl(Exporter) perl(ExtUtils::Manifest) perl(File::Basename) perl(File::Copy) perl(File::Path) perl(File::Spec) perl(File::Temp) perl(File::Which) perl(File::Which) >= 0.05 perl(File::stat) perl(FileHandle) perl(FindBin) perl(Getopt::Long) perl(IO::File) perl(List::Util) perl(Memoize) perl(Parrot::BuildUtil) perl(Parrot::Config) perl(Parrot::Config::Generated) perl(Parrot::Configure) perl(Parrot::Configure::Data) perl(Parrot::Configure::Options) perl(Parrot::Configure::Step::List) perl(Parrot::Configure::Utils) perl(Parrot::Distribution) perl(Parrot::Docs::Directory) perl(Parrot::Docs::File) perl(Parrot::Docs::Group) perl(Parrot::Docs::HTMLPage) perl(Parrot::Docs::Item) perl(Parrot::Docs::POD2HTML) perl(Parrot::Docs::Section::Compilers) perl(Parrot::Docs::Section::Developer) perl(Parrot::Docs::Section::Ops) perl(Parrot::Docs::Section::PDDs) perl(Parrot::Docs::Section::PMCs) perl(Parrot::Docs::Section::Tools) perl(Parrot::Docs::Text2HTML) perl(Parrot::IO::Directory) perl(Parrot::IO::File) perl(Parrot::Op) perl(Parrot::OpLib::core) perl(Parrot::OpTrans) perl(Parrot::Ops2c::Auxiliary) perl(Parrot::Ops2c::Utils) perl(Parrot::OpsFile) perl(Parrot::PMC) perl(Parrot::Pmc2c::Attribute) perl(Parrot::Pmc2c::ComposedMethod) perl(Parrot::Pmc2c::Dumper) perl(Parrot::Pmc2c::Emitter) perl(Parrot::Pmc2c::Library) perl(Parrot::Pmc2c::MULTI) perl(Parrot::Pmc2c::Method) perl(Parrot::Pmc2c::MethodEmitter) perl(Parrot::Pmc2c::PCCMETHOD) perl(Parrot::Pmc2c::PCCMETHOD_BITS) perl(Parrot::Pmc2c::PMC) perl(Parrot::Pmc2c::PMC::Null) perl(Parrot::Pmc2c::PMC::Object) perl(Parrot::Pmc2c::PMC::ParrotClass) perl(Parrot::Pmc2c::PMC::RO) perl(Parrot::Pmc2c::PMC::Ref) perl(Parrot::Pmc2c::PMC::SharedRef) perl(Parrot::Pmc2c::PMC::default) perl(Parrot::Pmc2c::PMCEmitter) perl(Parrot::Pmc2c::Parser) perl(Parrot::Pmc2c::Pmc2cMain) perl(Parrot::Pmc2c::UtilFunctions) perl(Parrot::Pmc2c::VTable) perl(Parrot::Test) perl(Parrot::Vtable) perl(Pod::Find) perl(Pod::Simple) perl(Pod::Simple) perl(Pod::Simple::Checker) perl(Pod::Simple::PullParser) perl(Pod::Simple::Text) perl(Storable) perl(Test::Builder) perl(Test::Harness) perl(Test::More) perl(Text::Balanced) perl(Text::Wrap) perl(base) perl(constant) perl(lib) perl(overload) perl(strict) perl(vars) perl(warnings) Processing files: parrot-debuginfo-1.0.0-6.fc9 Provides: digest_group.so.debug dynlexpad.so.debug gdbmhash.so.debug libnci_test.so.debug libparrot.so.1.0.0.debug perl(Parrot::Pmc2c::PCCMETHOD) rational.so.debug subproxy.so.debug Requires(rpmlib): rpmlib(CompressedFileNames) <= 3.0.4-1 rpmlib(PayloadFilesHavePrefix) <= 4.0-1 Requires: libparrot.so.1.0.0 perl(Carp) perl(Parrot::Pmc2c::PCCMETHOD_BITS) perl(constant) perl(strict) perl(warnings) Checking for unpackaged file(s): /usr/lib/rpm/check-files /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild warning: Could not canonicalize hostname: ppc7.fedora.phx.redhat.com Wrote: /builddir/build/RPMS/parrot-1.0.0-6.fc9.ppc.rpm Wrote: /builddir/build/RPMS/parrot-docs-1.0.0-6.fc9.ppc.rpm Wrote: /builddir/build/RPMS/parrot-devel-1.0.0-6.fc9.ppc.rpm Wrote: /builddir/build/RPMS/parrot-tools-1.0.0-6.fc9.ppc.rpm Wrote: /builddir/build/RPMS/parrot-debuginfo-1.0.0-6.fc9.ppc.rpm Executing(%clean): /bin/sh -e /var/tmp/rpm-tmp.40067 + umask 022 + cd /builddir/build/BUILD + cd parrot-1.0.0 + rm -rf /var/tmp/parrot-1.0.0-6.fc9-root-mockbuild + exit 0 Child returncode was: 0 LEAVE do -->